PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00088.1.g01930.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 334aa    MW: 36499.3 Da    PI: 6.426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00088.1.g01930.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.33.8e-14144193857
                                     HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                     +r+  NRe+ArrsR+RK+  +  Le  v  L+aeN +L k+l  ++++++
  Zjn_sc00088.1.g01930.1.sm.mkhc 144 IRMLANRESARRSRRRKQIHLNDLESQVSMLTAENASLLKRLVDMTEKYK 193
                                     6999********************************99977766666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-10130201IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-10144191No hitNo description
PROSITE patternPS000360145159IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.726145191IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-11145193No hitNo description
PfamPF001701.0E-11145193IPR004827Basic-leucine zipper domain
PfamPF124983.1E-18209314IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEKSCRDARQ KSGSFPRTAG FSGDEVAEVG CSYAAALKRE LDLYCAAVAK SMDAKSQESS  60
LGYPNSQASA SSELISQASF HGDRDGASLF INSHIIDNAD SQGMSANTGI LKEQSGDGDD  120
LEEITNPANL KKMRRITMLN LHFIRMLANR ESARRSRRRK QIHLNDLESQ VSMLTAENAS  180
LLKRLVDMTE KYKDATFDNQ NLIVDLAMMR RKVHIAEEAV RVTGASMLLP PTTSDMPVSS  240
MPLTSCASDA ASLAVPVQEN MHPFLQQPLI HGNQFKLDLP NATISLSSRE MITMAVSLRG  300
VASMENLQKT IHKDSVHSGT ALPLSDPEAL NDDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153160RRSRRRKQ
2155160SRRRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805357.11e-118light-inducible protein CPRF2-like
TrEMBLA0A2T7EIZ51e-118A0A2T7EIZ5_9POAL; Uncharacterized protein
STRINGPavir.Cb00258.1.p1e-112(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.13e-20bZIP family protein