PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 470aa    MW: 48306 Da    PI: 7.0346
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                                    r+ ++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLlqq++pai+++tgt++ +a ++ +++ +    ++s 179 PRNRDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIRWLLQQSEPAIIAATGTGTVPAIAT-TVDGVLRIPTQS 258
                                   6999********************************************************88888444.444444444444 PP

                           TCP  87 sgkaaksaakskksqksaasalnla 111
                                   s+++++sa    + ++s+a+ + + 259 SSSSSPSALAVVDGDESSAKRRRKL 283
                                   4433333332222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.381181235IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-30181273IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9458660.0EU945866.1 Zea mays clone 288123 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664491.31e-149transcription factor PCF2
SwissprotA2YXQ11e-145PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-145PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A317Y4S81e-146A0A317Y4S8_MAIZE; Transcription factor PCF2
STRINGORUFI08G24920.11e-144(Oryza rufipogon)
STRINGOS08T0544800-011e-144(Oryza sativa)
STRINGONIVA08G25460.11e-144(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.15e-41TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9