PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00067.1.g01880.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 681aa    MW: 72799.4 Da    PI: 5.5727
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00067.1.g01880.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.61.4e-1182826512374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaa 80 
                                   v +L++cA+ +++ d+++a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ ++a
  Zjn_sc00067.1.g01880.1.sm.mk 282 VGALTACADSLATCDQHAADYYLARLGEMASPAGpTPMHRVAAYFAEALAIRVVRMWPHLFDVTPPRELTDGAvDDDDAMA 362
                                   678*****************************************************************998886788999* PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleet 161
                                   l++++ v+Pi++f h+t N+ +l+a+eg++rvH+iDfdi+qGlQWp Llq+La+R+++p+++RiTgvg+    s++el+et
  Zjn_sc00067.1.g01880.1.sm.mk 363 LRILNAVTPIPRFLHFTLNERLLRAFEGHDRVHVIDFDIKQGLQWPGLLQSLAARASPPAHVRITGVGE----SRQELQET 439
                                   *********************************************************************....9******* PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                                   g rL+++A++lg+ fef++ v++rled++l++L+vk+gE++aVn+vl +hrll+++   +    ++L lv s+ + ++ + 
  Zjn_sc00067.1.g01880.1.sm.mk 440 GARLEHVAASLGLAFEFHA-VVDRLEDVRLWMLHVKRGECVAVNCVLTVHRLLRDESGAS--LADFLGLVGSTGAAILLLG 517
                                   *******************.7********************************6554444..589**************** PP

                          GRAS 243 eqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   e+e  +ns+++ +rf++al+yy+a fd++ +a+l+ +s +r+k E++ ++rei+n+va eg++r+erh t++ Wr+r+e++
  Zjn_sc00067.1.g01880.1.sm.mk 518 EHEDALNSGRWEARFARALRYYAAAFDAVdAAGLAYASPARTKAEEM-FAREIRNAVAFEGTDRFERHDTFAGWRRRMEDC 597
                                   *****************************9999**************.********************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   GFk++ +++++a+q +l+ r+++   yrv+ +   ++l+l W ++++++vSaW+
  Zjn_sc00067.1.g01880.1.sm.mk 598 GFKNAGIGDREAMQGRLISRMFAPGNYRVQAQgdGEALTLQWLNQAMYTVSAWT 651
                                   ***********************555***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.501255629IPR005202Transcription factor GRAS
PfamPF035144.9E-116282651IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MEVSACRSLG LAVVVAAVRA LRHSMLSLIQ EEEEEEEEGD EEEGNKFLLG TSHPAVSPIS  60
GMLAGCSFSS SRHQMSTTPR FDILQCGFSK RSNRGGDGAA APRVAAADPR AGGGNCSFRA  120
HPAPVTQAVS WGAKQEPSGN VAGGFWERSR AIKRAHEEDA VEEYGGPTVR AKRTRMGGDG  180
DEVWFHQSIA GTVQQAAPGE GEESEEEKVF LVPSAATFPH GMAAAGPSLA AAKQEFSNSP  240
SPASSGGTDG GGTSAVPPPP QVHARNGVPA HGEAGRETME LVGALTACAD SLATCDQHAA  300
DYYLARLGEM ASPAGPTPMH RVAAYFAEAL AIRVVRMWPH LFDVTPPREL TDGAVDDDDA  360
MALRILNAVT PIPRFLHFTL NERLLRAFEG HDRVHVIDFD IKQGLQWPGL LQSLAARASP  420
PAHVRITGVG ESRQELQETG ARLEHVAASL GLAFEFHAVV DRLEDVRLWM LHVKRGECVA  480
VNCVLTVHRL LRDESGASLA DFLGLVGSTG AAILLLGEHE DALNSGRWEA RFARALRYYA  540
AAFDAVDAAG LAYASPARTK AEEMFAREIR NAVAFEGTDR FERHDTFAGW RRRMEDCGFK  600
NAGIGDREAM QGRLISRMFA PGNYRVQAQG DGEALTLQWL NQAMYTVSAW TPASDGDAGG  660
STVSASLSVS VSTTASHSQQ S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-5928865426382Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812393.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9LWU90.0DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLA0A1E5WNH30.0A0A1E5WNH3_9POAL; Scarecrow-like protein 28
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-126GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]