PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00062.1.g00250.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 384aa    MW: 42552.2 Da    PI: 7.1717
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00062.1.g00250.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS184.38.5e-572329775337
                          GRAS  75 seelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgsk 155
                                   +   aa++ f  ++P++ ++  + N+aIl a++ e++vHi+D++  ++ QW  L++ +a+R++gppslR+T+v++    + 
  Zjn_sc00062.1.g00250.1.am.mk  23 AAINAARRSFAALCPLVHVAATAVNHAILGAMAAEHAVHIVDLGGANPNQWFELIRLFAARSRGPPSLRLTVVNE----ED 99 
                                   455678899******************************************************************....99 PP

                          GRAS 156 eeleetgerLakfAeelgvpfefnvl..vakrledleleeLrvkp.gEalaVnlvlqlhrll...........desvsles 222
                                   + l++++  L++ A +lgv+f fn++  + ++++  ++ +Lrv + +Eal++ + lqlhrl            +e     +
  Zjn_sc00062.1.g00250.1.am.mk 100 DFLSSVAGLLTQEAVRLGVNFMFNPVrsHIDHFTPADVAALRVVQgREALVITSTLQLHRLIadevtinlpvvAE-----N 175
                                   *************************8666667777799999999999***************5555555555333.....1 PP

                          GRAS 223 ....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak...lpreseerikvErellgreivn 296
                                       + d++L+++++ + k+vv++e ea hn+e +  r+ +a++yy+al+  le +   l++e  +r+ vEr+ll++e+++
  Zjn_sc00062.1.g00250.1.am.mk 176 niitKADALLRVLRDQKLKLVVLTELEAHHNDEALKCRVDNAFDYYAALLHDLEIGadgLASEVADRVAVERVLLRNEVMD 256
                                   344469********************************************99965533388888***************** PP

                          GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                                   +va  g  rrerhe++ +W  +++ aGF+ +p+++ + k+ 
  Zjn_sc00062.1.g00250.1.am.mk 257 IVAGYGVLRRERHEKMTRWLTQMTVAGFELIPMTYGVFKET 297
                                   *******************************9998777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.0681314IPR005202Transcription factor GRAS
PfamPF035143.0E-5423297IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MRLLPGLAWA MQLQVPPLPT TPAAINAARR SFAALCPLVH VAATAVNHAI LGAMAAEHAV  60
HIVDLGGANP NQWFELIRLF AARSRGPPSL RLTVVNEEDD FLSSVAGLLT QEAVRLGVNF  120
MFNPVRSHID HFTPADVAAL RVVQGREALV ITSTLQLHRL IADEVTINLP VVAENNIITK  180
ADALLRVLRD QKLKLVVLTE LEAHHNDEAL KCRVDNAFDY YAALLHDLEI GADGLASEVA  240
DRVAVERVLL RNEVMDIVAG YGVLRRERHE KMTRWLTQMT VAGFELIPMT YGVFKETAIT  300
AHLLRTQVAT MRCPPARGTH QTRQLGQVEL AGAREAEGIA WWGKPGKQRR ACSGEMEDDV  360
RLASRPWLAY DECWRRWMVV SASC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-183629087329GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.15e-85hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-104K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.17e-39scarecrow-like 3