PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00052.1.g00440.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 631aa    MW: 71300 Da    PI: 5.2476
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00052.1.g00440.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS266.96.8e-822486063360
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lL++cA+av++++ + a +lL+++++ as +g+++qRla +f+++L+arla+++++ly+    ++ s   ++e l a++l
  Zjn_sc00052.1.g00440.1.am.mk 248 TLLTHCAQAVAANNRASAWQLLNQIKQDASTTGNATQRLARCFAKGLEARLAGTGTQLYQFRMGEPPS---TVEYLEAYQL 325
                                   68*********************************************************877766666...89******** PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQ..WpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   ++ v+ + k++     ++I++ + g+++vHi+D+++ + +Q  W+ Ll+ La+R++g+p+++iT++++p +    +e++ee
  Zjn_sc00052.1.g00440.1.am.mk 326 YVSVCSFDKVALCFSAKTIVDTIVGKSKVHIVDYGLDYAFQlrWAGLLELLANREGGSPEVKITAINHPGHWfyPAEQMEE 406
                                   ***********************************99998888*************************99889******** PP

                          GRAS 161 tgerLakfAeelgvp.fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkv 238
                                   tg+rL+k A+elg++ f+f++ + k++ed+ +++L+++++E+l+Vn +++l +l+desv  ++  +rd+vL+ + +++P v
  Zjn_sc00052.1.g00440.1.am.mk 407 TGSRLHKWAAELGLRyFKFHT-IKKKWEDVCIQDLDTESNEVLIVNDHFNLSTLMDESVFFDDpcPRDAVLSNIAKMRPAV 486
                                   **************77*****.7************************************9999999*************** PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                                   ++    ++ + ++sFl rf  al yy+alfd+l+a++pres++r+++E+el+g  +vnv+a eg + ++  e++ +W++r 
  Zjn_sc00052.1.g00440.1.am.mk 487 FIQNVVNCTY-GTSFLSRFRGALFYYMALFDMLDATIPRESKQRVVLEQELFGGYAVNVIASEGVNVVQHPEKYTQWQARN 566
                                   **99999999.679******************************************************************* PP

                          GRAS 320 eeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                                   ++aG++++pl+ +++k++ + ++k+++d + + e+ ++l++
  Zjn_sc00052.1.g00440.1.am.mk 567 QRAGLRQIPLKPYIVKEVASKIKKHHKD-FLLSEDGHWLLQ 606
                                   **************************77.*****9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.873220601IPR005202Transcription factor GRAS
PfamPF035142.3E-79248606IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MTPTPEEFFV HCLMEQSPPS PSLCPDLPSL PDAYGEGWLF PNEMMLPHIS RMLMEDDTEE  60
KLSDDPALLR VQQPFAEILF DPSFGTDMGN NVNRRGNTEG PMDLMQDGSC YQMTAESAFA  120
KGADAVGAFL RGMEEAKTFL PKYGSFREDD LVSQLFREST NHGGPRTNNS KDDLLEAAVS  180
MTDEPMTMTK EQAERVDASE MLDGMMWQGC EKFVRDMEKL RITMANEAEE DRRKDRSNTA  240
RVVVDLPTLL THCAQAVAAN NRASAWQLLN QIKQDASTTG NATQRLARCF AKGLEARLAG  300
TGTQLYQFRM GEPPSTVEYL EAYQLYVSVC SFDKVALCFS AKTIVDTIVG KSKVHIVDYG  360
LDYAFQLRWA GLLELLANRE GGSPEVKITA INHPGHWFYP AEQMEETGSR LHKWAAELGL  420
RYFKFHTIKK KWEDVCIQDL DTESNEVLIV NDHFNLSTLM DESVFFDDPC PRDAVLSNIA  480
KMRPAVFIQN VVNCTYGTSF LSRFRGALFY YMALFDMLDA TIPRESKQRV VLEQELFGGY  540
AVNVIASEGV NVVQHPEKYT QWQARNQRAG LRQIPLKPYI VKEVASKIKK HHKDFLLSED  600
GHWLLQGLAR MHPHQRDVRH VAAPIRDSAS P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-282505798331GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-95GRAS family protein