PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00050.1.g01950.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 402aa    MW: 42331.5 Da    PI: 8.4786
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00050.1.g01950.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.65.6e-311452406107
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                                    rh ++hTkv+gR+RR+Rl   caar+  L++eLG++ d++ti WLlqq++pa++++tgt++ +a ++ +++ +   +   
  Zjn_sc00050.1.g01950.1.am.mk 145 PRHRDRHTKVEGRGRRIRLAEACAARIARLTRELGHKNDGETIRWLLQQSEPAVIAATGTGTVPAIAT-TVDGVLRLH--- 221
                                   69**********************************************************88888444.333333333... PP

                           TCP  87 sgkaaksaakskksqksaasa 107
                                     ++ ++a    ++q +++  
  Zjn_sc00050.1.g01950.1.am.mk 222 --SSPPAAVADGDQQPDPKRR 240
                                   ..2222222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-24147221IPR005333Transcription factor, TCP
PROSITE profilePS5136921.597147201IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MGRIFPSSRL PSISSGPVGR LPLNPTLRDP LSQRRSKNRS RELAQRRAPP NQNKGAESKK  60
PERETKARLA PIRSPLGSPA PDMGEEDVAA FYHAAGNGTV VTDAAVVGID AMGSSEAHGS  120
LMPKPEPAPV EFLGELQVAN RRPAPRHRDR HTKVEGRGRR IRLAEACAAR IARLTRELGH  180
KNDGETIRWL LQQSEPAVIA ATGTGTVPAI ATTVDGVLRL HSSPPAAVAD GDQQPDPKRR  240
RKLQPTRAAA AGATAPPLTS TPTAYYPVVA DPLLQGNGGG AISTSSGLAP ASVPTPPPGA  300
IPFLAIPAPG PGATIDGKQM MKPTAVWMVP PQAGAGGAAN QPTHYWAFPT NPELFSNFQQ  360
QAVYDAGQLV DGGESQHQQL EGHQDGEGEE EDIALTESSS EE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236242PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.11e-129transcription factor PCF2-like
SwissprotA2YXQ14e-80PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH64e-80PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A2T7EUU11e-128A0A2T7EUU1_9POAL; Uncharacterized protein
STRINGSb02g030260.11e-123(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-35TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]