PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00039.1.g03400.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 481aa    MW: 51695.2 Da    PI: 10.1581
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00039.1.g03400.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer88.19e-28304359258
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   ++vrY eC++NhAas+Gg+++DGC+Ef+++ geegt  +lkCaACgCHR+FHRr ++
  Zjn_sc00039.1.g03400.1.am.mk 304 CSVRYGECRRNHAASTGGYSIDGCREFIAE-GEEGTGGGLKCAACGCHRSFHRRVQV 359
                                   789**************************8.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-22285361IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-27306358IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-20307356IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.255308357IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MEQIKTSGGR VSGSCVRKLM ARRRVKLMRN QLQEAEATLE SSTTLGSRAV ASAPFCLHPT  60
RAGSTGTRSC CFLLLPACWL ALVLFPGPPA PTFYSALSLS TSLAGGGSAR QGRGVGLLVA  120
AFFLGEGEGE GGLGCQCGGE GEELLQWWRW LGTSRRQGSG VGDNALCAAA VPEVARRSYC  180
GAGVVGCRHS TAVSSGRRRA EKGGKVGARA RHGDDDGGVR PVRGEKASRR AGQASVPFLS  240
PVSGGDVAAA GASSLPVVHS QRHGRPYISR GAESFGWLER GRKLVMKRLL ILRRCEPIVR  300
FTCCSVRYGE CRRNHAASTG GYSIDGCREF IAEGEEGTGG GLKCAACGCH RSFHRRVQVF  360
EALELDPRKQ FVTSRVPCTR LDPQYMCRRS VIQRILFTLE SRITCDGAPG LGERTTRAEI  420
SSRRRAILPG ELNELQCTTA RAPELTLVSE QQLWELMART GNGSGLVLNA AASWWIRWKV  480
V
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-22mini zinc finger 2