PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00038.1.g02750.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 858aa    MW: 94632.1 Da    PI: 8.0078
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00038.1.g02750.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.29.6e-1094778481373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zjn_sc00038.1.g02750.1.am.mk 477 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 554
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I +a  g++++Hi+D++i +G+QWp++l++++ R++gpp++ iTg++ p++g   +e++ee
  Zjn_sc00038.1.g02750.1.am.mk 555 QLYMAAICFKKVAFIFSNYTIFNASLGKKKIHIVDYGIHYGFQWPCFLKQISGREGGPPEVTITGIDLPQPGfrPTERIEE 635
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL+++A+e+gvpf++++++a+++e+++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd vL+ +++++P+ +++
  Zjn_sc00038.1.g02750.1.am.mk 636 TGRRLSNYAREFGVPFKYHAIAASKMESVRKEDLNIDPDEVLIVNCMYQFKNLMDESVVIESPRDVVLNNIRKMQPHTFIH 716
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++a
  Zjn_sc00038.1.g02750.1.am.mk 717 AIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRA 797
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zjn_sc00038.1.g02750.1.am.mk 798 GLKQLPLNRETVEIVRGKVKDCYHKDFVIDIDHHWLLQGWKGRILFAISTW 848
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.987451829IPR005202Transcription factor GRAS
PfamPF035143.3E-106477848IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MGADDCHALK QQNGLALAPD RNVVLRAART RTPEGSVRRA ATSDLTARVA GFRRRRRDLV  60
EAIKLFRPTR SGNKVCFALG LGAGRRACGR RIQRVQTYVA SEVGARGLSQ QSEIHGASVG  120
HEIVIQTEYV YQRTVSSSLF VWSRTQVDGV ERLILFRFNL PRISAVSKSP FPPPPSRNLP  180
LPVSTPCPPA AYKSTPSPLS LSSSRARPRP ATHAAAMGSS YDLYQSPGAD DPSLYLYLSD  240
LVPDSPSAYL DLPPTPHHEQ QQPPPVPTAA TDDGAAAGSP EDLVLPYISR MLMEDDIEDK  300
FFYDYPDNPS LLQAQQPFLE ILSNSDDTTT TTTTTSSSGG DHHGDPSPTS SSSDGASAPA  360
PSPAPPVAPA VTLSVKEELV DAAPGNGVGR GRKNPYDHDE LEVEGGRSSK QSAVQGEDDA  420
TRDMLDRVMM PSHEACVLQM QQLRIAMQEE AAKNEAGGKA GNGKAKGRRG GRDVVDLRTL  480
LIHCAQAVAT DDRRSATELL KQIKQHASPQ GDATQRLAHC FAEGLQARLA GTGSMVYQSL  540
MAKRTSAVAL LQAYQLYMAA ICFKKVAFIF SNYTIFNASL GKKKIHIVDY GIHYGFQWPC  600
FLKQISGREG GPPEVTITGI DLPQPGFRPT ERIEETGRRL SNYAREFGVP FKYHAIAASK  660
MESVRKEDLN IDPDEVLIVN CMYQFKNLMD ESVVIESPRD VVLNNIRKMQ PHTFIHAIVN  720
GSFSAPFFVT RFREALFYYS ALFDVLDTTT PRDSDQRMLI EQNIFGRSAL NVIACEGTDR  780
VERPETYKQW QVRNQRAGLK QLPLNRETVE IVRGKVKDCY HKDFVIDIDH HWLLQGWKGR  840
ILFAISTWVA NDAGCPYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-444818488374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-163SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-151GRAS family protein