PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00031.1.g00600.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 229aa    MW: 25178.8 Da    PI: 8.5027
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00031.1.g00600.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.51e-30155211360
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                   +v+Y+eC++NhAas+Gg+avDGC+Efm+  g+egta+al+CaAC CHR+FHRrev++e
  Zjn_sc00031.1.g00600.1.am.mk 155 AVHYRECQRNHAASIGGYAVDGCREFMAL-GAEGTAEALTCAACSCHRSFHRREVDDE 211
                                   799*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.5E-29156208IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-20156211IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.1E-25157208IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.274158207IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MADTLGLMVP LRPPVTVLWI NRFVTMDCLN IQRPALVACR TFIEQKAKQL EPNQTHPGRK  60
DQEAFNRTQH LRMRIHIRRR TKEAPAAMIL LQPPSYWEQR SRAGWLLLLL FLPVTSLPSG  120
SILLAVLSMG PKQDPSTANG AAASARKETS TKAAAVHYRE CQRNHAASIG GYAVDGCREF  180
MALGAEGTAE ALTCAACSCH RSFHRREVDD EADNDCVDCS STSTTTSSG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGSi027403m1e-36(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.18e-28mini zinc finger 1