PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00027.1.g04500.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family VOZ
Protein Properties Length: 382aa    MW: 41687.2 Da    PI: 4.8658
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00027.1.g04500.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ1554.7e-48283378296
                             VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipe 79 
                                     +ps++lgpkcalwdc+rp++gse++qdyc+ fha++aln+ gl+g++pv+rp+gi+lkdg+lf al akvqgk+vgip+
  Zjn_sc00027.1.g04500.1.am.mkhc 283 SPSQYLGPKCALWDCSRPVRGSEECQDYCNPFHADFALNDdGLLGIRPVMRPRGIELKDGPLFVALIAKVQGKNVGIPV 361
                                     7**************************************9799************************************ PP

                             VOZ  80 cegaatakspwnaaelf 96 
                                     c+gaat+kspwna+  f
  Zjn_sc00027.1.g04500.1.am.mkhc 362 CKGAATSKSPWNAPGKF 378
                                     *************9766 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MAGDPAAGAG ADHPVSAGKV SRSSTRHRQF RDCAKTRVDD LQEMFSGLQS ARKENRSADA  60
AVLEEQVHQM LREWRAELSV PSPASSLQAR SRNPSGHPSA SPFGSQGNNT GAPCPASETL  120
RLLQLAVAEE DDATSKLADP QSPLRLPDSQ HNLYEHEHGR DCWMPNPEQR GEGAQQSMEH  180
RVQGGCGEVA VANAFNDQMY FIDHELNIDD FLRDDDDYKI NIPGSNQDEV NNLSEIGQME  240
HQQFNFPVDL PPHSSSVDVN NSVQDTGDVF IHMSDLLTTI CASPSQYLGP KCALWDCSRP  300
VRGSEECQDY CNPFHADFAL NDDGLLGIRP VMRPRGIELK DGPLFVALIA KVQGKNVGIP  360
VCKGAATSKS PWNAPGKFVS TC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961501.10.0transcription factor VOZ1
TrEMBLK3Z4V00.0K3Z4V0_SETIT; Uncharacterized protein
STRINGSi021568m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-67vascular plant one zinc finger protein