PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00025.1.g02060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 461aa    MW: 49742.4 Da    PI: 9.9998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00025.1.g02060.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.8e-491132382128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y ++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t sgy
  Zjn_sc00025.1.g02060.1.am.mk 113 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYCFDPWELPARAVMGGKEWFFYVPRDRKYRNGDRPNRVTVSGY 192
                                   79***************************.99***************8777899*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zjn_sc00025.1.g02060.1.am.mk 193 WKATGADRMIRGENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 238
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-57112262IPR003441NAC domain
PROSITE profilePS5100554.777112262IPR003441NAC domain
PfamPF023655.8E-24114238IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MRTRPPTARP GARQPRCPSA PPARPGIWLA LSPSGSFRAA WRMTARAALQ LRQGRLGRVS  60
RCLRAACARY AMSRDLDDWH YGAAGGAAAG SSGESMGGGG EAAGDSHDND LVMPGFRFHP  120
TEEELIEFYL RRKVEGRRFN VDLIADLDLY CFDPWELPAR AVMGGKEWFF YVPRDRKYRN  180
GDRPNRVTVS GYWKATGADR MIRGENSRPI GLKKTLVFYS GKAPKGVRSS WIMNEYRLPP  240
PAADAEPLTH KSEISLCRVY KRSGIDDGRG QPSSSSTQAS AGRRTRAGRH MSTSPASSPL  300
SPIPSSFHLL QGECPSASPP AIMDQMMITA DNVSQLVLPP TARAFAPSGN SLAAVAPAEG  360
ATILASTDSL LNMAAVPMGI SGPVDKLGTV VGDSQAYANH ISAATGSDFL PLPSTQPMSQ  420
VAPLGALPMT APLSSIDDKL GWDWNPVPDT RTRDYRTSIF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-5411426319166NO APICAL MERISTEM PROTEIN
1ut4_B7e-5411426319166NO APICAL MERISTEM PROTEIN
1ut7_A7e-5411426319166NO APICAL MERISTEM PROTEIN
1ut7_B7e-5411426319166NO APICAL MERISTEM PROTEIN
4dul_A7e-5411426319166NAC domain-containing protein 19
4dul_B7e-5411426319166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-155PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK3Z6L91e-155K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.13e-90NAC domain containing protein 35