Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 461aa    MW: 49742.4 Da    PI: 9.9998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y ++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t sgy 113 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYCFDPWELPARAVMGGKEWFFYVPRDRKYRNGDRPNRVTVSGY 192
                                   79***************************.99***************8777899*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl 193 WKATGADRMIRGENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 238
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-57112262IPR003441NAC domain
PROSITE profilePS5100554.777112262IPR003441NAC domain
PfamPF023655.8E-24114238IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5311426319166NO APICAL MERISTEM PROTEIN
1ut4_B1e-5311426319166NO APICAL MERISTEM PROTEIN
1ut7_A1e-5311426319166NO APICAL MERISTEM PROTEIN
1ut7_B1e-5311426319166NO APICAL MERISTEM PROTEIN
4dul_A1e-5311426319166NAC domain-containing protein 19
4dul_B1e-5311426319166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-154NAC domain-containing protein 35
TrEMBLK3Z6L91e-153K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-153(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.13e-90NAC domain containing protein 35