PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00023.1.g01030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 626aa    MW: 65836.5 Da    PI: 8.0302
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00023.1.g01030.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.96.8e-892596262374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                   ++lL e+A a+++g+ e a + La l+  a+p+gd  qRl+++++ AL++r+a      +++ p+++ +e    e+ +  +
  Zjn_sc00023.1.g01030.1.sm.mk 259 RQLLSEAAVAIADGNIETAATHLAVLKRAANPRGDVEQRLISMMVAALSSRIAP-----AASSPAEHLAELCGPEQRTGSQ 334
                                   789***************************************************.....3333444444444666667779 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeele 159
                                   l+++ sP+++++  +aN aI+eav  ++++H +Dfd+s + Q +aL q La+R+ +  sl++T++ +p+s     ++ +l 
  Zjn_sc00023.1.g01030.1.sm.mk 335 LLHDRSPCFRLALHAANVAIVEAVGDHRAIHLVDFDVSAP-QHAALVQYLADRRVPGTSLKVTAITDPSSPfaqsQTATLP 414
                                   *************************************987.99************************998889999999** PP

                          GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                   ++gerL+k+A++ g++ +f++ v+ r ++l+ ++L ++pg alaVnl+++l +++desvs +++rde+L+ v+ l P+vv 
  Zjn_sc00023.1.g01030.1.sm.mk 415 AVGERLKKLADRAGIEYRFKM-VSCRAAELDASKLGCEPGGALAVNLAFALSHVPDESVSPANTRDELLRRVRALGPQVVA 494
                                   ********************9.7999******************************************************* PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   ++eqe+++n++++++rf++a+ +y a++dslea+l+r++ er++ E + l+++++n+v  eg++r er+e ++kWr+r+++
  Zjn_sc00023.1.g01030.1.sm.mk 495 LIEQELNTNTAPLAARFTDACAHYGAILDSLEATLGRDNAERTMPESA-LAKKASNAVGREGSDRLERCEVFGKWRARFGM 574
                                   *********************************************999.9******************************* PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   aGF+pv+l+ ++a+q+ +    ++    +++ e+g l +gW++r ++++SaWr
  Zjn_sc00023.1.g01030.1.sm.mk 575 AGFRPVALNPSIADQVVARCGPTP-PALSMKTENGVLRIGWMGRVVTVASAWR 626
                                   ******************999999.559************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.169232607IPR005202Transcription factor GRAS
PfamPF035142.3E-86259626IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGFGS AMQIPLQQQQ RPDAVAAGGV LKRSLGELER WQHQQNQQVA  60
AQQALYLRAV RQRTAAATDI AALLGGTPSH RPMVLSGSSY GGALASPSST LSSLTTASGA  120
AVPLMQPQMQ RQVQPLMASS QQKPQAALGV SRAALPPPAV SSDMFLLQEL EKQLLGDDDE  180
PVAAMSGTGS AVTNSEWEET MQQLNSITAA PSPVVPAAAT PNNNNNPGMT RSPSNSSSST  240
ASSSASCSPP TPGAAAATRQ LLSEAAVAIA DGNIETAATH LAVLKRAANP RGDVEQRLIS  300
MMVAALSSRI APAASSPAEH LAELCGPEQR TGSQLLHDRS PCFRLALHAA NVAIVEAVGD  360
HRAIHLVDFD VSAPQHAALV QYLADRRVPG TSLKVTAITD PSSPFAQSQT ATLPAVGERL  420
KKLADRAGIE YRFKMVSCRA AELDASKLGC EPGGALAVNL AFALSHVPDE SVSPANTRDE  480
LLRRVRALGP QVVALIEQEL NTNTAPLAAR FTDACAHYGA ILDSLEATLG RDNAERTMPE  540
SALAKKASNA VGREGSDRLE RCEVFGKWRA RFGMAGFRPV ALNPSIADQV VARCGPTPPA  600
LSMKTENGVL RIGWMGRVVT VASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3627762622375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-87SCARECROW-like 8