PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g05360.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 902aa    MW: 94259.2 Da    PI: 9.545
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g05360.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.31.2e-923377002373
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaa 80 
                                   ++lL ++A av++g+++ a a La l+  a+p+gd+ qRl+a++t AL++r+           p+s+    +    e+ aa
  Zjn_sc00022.1.g05360.1.am.mk 337 RQLLSDAAAAVADGNQTVAAAHLAVLKISANPRGDAEQRLVAMMTGALSSRVGP---------PSSQHLV-DlcGGEQRAA 407
                                   6899*************************************************9.........2222222.2236667789 PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skee 157
                                    +l+++vsP++ ++   aN aIl+av+ ++++H++Dfd+s  +Q +aL+qaL +R++   sl+iT+v++p+s      +++
  Zjn_sc00022.1.g05360.1.am.mk 408 CQLLHDVSPCFGLALHGANLAILDAVADHRAIHVVDFDVSI-AQHIALIQALGNRRAAGTSLKITAVADPTSPftpaLAQA 487
                                   9**************************************97.79*************************9988899999** PP

                          GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkv 238
                                   l +t erL++ A++ gv+f+f++ v+ + +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+v
  Zjn_sc00022.1.g05360.1.am.mk 488 LASTTERLKRHAQQAGVEFRFKA-VSCSAAEIEASRLGCQPGEALAVNLAFILSRVPDESVSPANPRDELLRRVRALGPRV 567
                                   ***********************.6889999************************************************** PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                                   v++veqe+++n++++++rf++a+ +y a+++sl+a+l r+s +r++ E++ l+ +++n+va ega+r+er+e ++kWr+r+
  Zjn_sc00022.1.g05360.1.am.mk 568 VTLVEQELNTNTAPLAARFADACAHYGAVLESLDATLCRDSAQRAWAEAA-LASKACNAVAREGADRVERCEVFGKWRARF 647
                                   *************************************************9.999*************************** PP

                          GRAS 320 eeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   ++aG++pv++++ +a+ +k+ l      g+ v+ ++g l  gW++r ++++SaW
  Zjn_sc00022.1.g05360.1.am.mk 648 GMAGLRPVAIGQGVADRVKARLGPAR-PGFDVKLDNGRLGVGWMGRVVTVASAW 700
                                   ***********************999.9************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.781310682IPR005202Transcription factor GRAS
PfamPF035144.0E-90337700IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 902 aa     Download sequence    Send to blast
MLSSPAPIPP IGQIRPAAVV APRRQRHCCR TGVLASDPKQ SQEYINIRPT LLSFSYRSTL  60
LFVPSPLSAA SAPGFSGMEP AGWCDPRRRA YGYGYGVGSA VDAPPMMRQQ QHPPAASRPD  120
AAAGPTGSVL KRSLSEMERW QQALCLRAVK QRTAAPVPPG HHQLDIGAVL AGAASARARG  180
LSGQPSAGFA GPSPQPSSTL SSLTTASPMQ QLWQRQVMAA PSAPVAKGAA ATARPTTARE  240
MVLLRELEKQ LLGDDEEVEA EAAGSVCGSA VTNSGWGETI HELNSIAATP LPSHPKTMTA  300
TNRYNTAPMS RSPSNSTSSA TSSTASSSPP TSAASSRQLL SDAAAAVADG NQTVAAAHLA  360
VLKISANPRG DAEQRLVAMM TGALSSRVGP PSSQHLVDLC GGEQRAACQL LHDVSPCFGL  420
ALHGANLAIL DAVADHRAIH VVDFDVSIAQ HIALIQALGN RRAAGTSLKI TAVADPTSPF  480
TPALAQALAS TTERLKRHAQ QAGVEFRFKA VSCSAAEIEA SRLGCQPGEA LAVNLAFILS  540
RVPDESVSPA NPRDELLRRV RALGPRVVTL VEQELNTNTA PLAARFADAC AHYGAVLESL  600
DATLCRDSAQ RAWAEAALAS KACNAVAREG ADRVERCEVF GKWRARFGMA GLRPVAIGQG  660
VADRVKARLG PARPGFDVKL DNGRLGVGWM GRVVTVASAW AWGASVDMIS LLVTPVVSAD  720
SLAGFLLLSG FTMGCVRAHG MELSPPRSSK TSGAGRCARE QSKATAGSES ARARLNPESA  780
CSLSVSSRAV ALQAVEFQAC RWLNGPPFRL LFSTLGPRTS LSCLIRPFLF QLSLDLRELS  840
VGWLRQLDGG SLSPSLDATA ETKRGGDAYG TQRLVRLGHA GEGRFKNASL VGCSSSGGHG  900
TA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-373327001374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0A9FCJ70.0A0A0A9FCJ7_ARUDO; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-91SCARECROW-like 8