PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00016.1.g06930.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 815aa    MW: 90636.5 Da    PI: 5.1902
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00016.1.g06930.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS354.12.2e-1084348061373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++ L++cA+a+s+gdl+ a+++L+++++++s +g++++Rla++f+++L+arla+++s++yk+l ++ ts   +++ l+a+
  Zjn_sc00016.1.g06930.1.am.mk 434 LRTMLIHCAQALSTGDLRGANEMLKQIKQHSSLTGNATERLAHCFAQGLEARLAGTGSQVYKSLMSKCTS---VVDYLKAY 511
                                   5789*************************************************************99999...******** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   klf  +s + k+ h+  N++I +av+g++++Hi+ +++++G+QWp Ll+ La+R++gpp++R Tg++ p++g   + +le+
  Zjn_sc00016.1.g06930.1.am.mk 512 KLFMAASCFKKVKHVFSNRTIADAVAGKSKLHIVEYGVQHGFQWPGLLHFLANREGGPPEVRFTGIDLPQPGfrPAYQLEK 592
                                   ***********************************************************************9999****** PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvv 239
                                   tgerL++ A++++vpf+f++ +a ++e++++e+L+++p+E+l+Vn+   l +l+de+v ++s  +rd vLk +++++Pkv+
  Zjn_sc00016.1.g06930.1.am.mk 593 TGERLSNCARQFRVPFKFHA-IAAKWETVTPEDLNIDPDEVLVVNCECYLDKLMDETVVVDSpsPRDMVLKNIRNMRPKVF 672
                                   ********************.799*********************************98888779**************** PP

                          GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                                   v++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  +Er +lgr++ nv+acega+r+er et+++W+ r +
  Zjn_sc00016.1.g06930.1.am.mk 673 VHCVVNGTFGAPFFLTRFREALFFYSAQFDMLDATIPRDNDVRLLIERDILGRSALNVIACEGADRVERPETYKQWQVRNN 753
                                   ********************************************************************************* PP

                          GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   +aG++++pl+ +++k ++  +++++ + + ++e++ +l++gWk+r L+++S W
  Zjn_sc00016.1.g06930.1.am.mk 754 RAGLRQLPLRPEIVKLVRDKVKNHYHKDFLLDEDHRWLLQGWKGRVLYAISTW 806
                                   *************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.697408787IPR005202Transcription factor GRAS
PfamPF035147.6E-106434806IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
LHLVYSSTVP SADPVAAAVA SPFRRLPGRF PLSPPSSRLQ STPEALIFNS IHVSAHPTSA  60
TPLLLAMAAT PEDFLGQGGY LAVPEPFSPS VFLDLPPTPR PDGGDDPASS DDLVLPFISR  120
MLMEEDIDEN FFYQYPDHPA LLTLQQPYAE ILSAPSSSSD SATTNTTLTL SSFSDAAEPT  180
WPYDPIELAQ LLRSPPCPDE GLGLHDFTAD DDSAVLFDGA TPGFEQISMV DASPNDGGEA  240
IQSSGSWGAA EEEDTKTNIA TLPAADEDHD ALASAFFGGH RAVNMDMLNR AFAKGMEEAK  300
KFLPANSGLF VDLDATTTEH LPTNSKPLTV CNVKKEEVLV DGLSIFRERS NGRGRKNRHH  360
EDDLEMEIGR SSKLMMQEQE DSDAQEMYRE IMSFNVEEFM KRMQDLRIAK DSESEKSSRK  420
GVRGRQGADE VVDLRTMLIH CAQALSTGDL RGANEMLKQI KQHSSLTGNA TERLAHCFAQ  480
GLEARLAGTG SQVYKSLMSK CTSVVDYLKA YKLFMAASCF KKVKHVFSNR TIADAVAGKS  540
KLHIVEYGVQ HGFQWPGLLH FLANREGGPP EVRFTGIDLP QPGFRPAYQL EKTGERLSNC  600
ARQFRVPFKF HAIAAKWETV TPEDLNIDPD EVLVVNCECY LDKLMDETVV VDSPSPRDMV  660
LKNIRNMRPK VFVHCVVNGT FGAPFFLTRF REALFFYSAQ FDMLDATIPR DNDVRLLIER  720
DILGRSALNV IACEGADRVE RPETYKQWQV RNNRAGLRQL PLRPEIVKLV RDKVKNHYHK  780
DFLLDEDHRW LLQGWKGRVL YAISTWVAEG SNSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-374388068374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450062.10.0hypothetical protein SORBIDRAFT_05g027740
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-151SCARECROW-like 14