PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g01720.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 579aa    MW: 63850.7 Da    PI: 10.4138
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g01720.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57382.46.5e-26320414297
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +f r+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  +
  Zjn_sc00014.1.g01720.1.am.mk 320 KFPRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVAKGLDPARLA 399
                                   699******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+
  Zjn_sc00014.1.g01720.1.am.mk 400 PHDRDVLHLCSRLWD 414
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1610842.88E-3555166No hitNo description
Gene3DG3DSA:1.20.120.5507.1E-4258175IPR023352Membrane associated eicosanoid/glutathione metabolism-like domain
PfamPF011245.0E-2165162IPR001129Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein
PfamPF045041.1E-23321414IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005773Cellular Componentvacuole
GO:0005783Cellular Componentendoplasmic reticulum
GO:0005794Cellular ComponentGolgi apparatus
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MRPDGPPHPP ELSWAGGQSQ ILEALEKPFS LRHVCPFLRR KKREVWREEA MAVSIPLTKE  60
YGYVVLVLVA YAFLNFWMGF EVGKARRKYK VSHPTMYAVE SENKDAKLFN CVQRGHQNSL  120
EMMPMFFVML FVGGLQHPTI AAGLALLYTV ARFFYFKAYS TGVPENCLKI GSATPRAVKT  180
MDRKPRKSRA IEPIHPDSSA SNPVPSPSFP NPETEAAVTP SGHAARDPIR PPTTPLPRPV  240
SFSSHLACPR ACSPIRARHG LGRPTDPSGP RPRPPDPTAP SGARKLPIKR RSPRPSSSSP  300
PSSGSDQQQG QEQERQPPFK FPRIWSESDE LRFLQGLLGC GAQGLVFPRD LNVFYDRFSE  360
SMPQPYTRSQ LSEKLRRLKN KFRSMSARVA KGLDPARLAP HDRDVLHLCS RLWDPANAAT  420
SPFAASAGTG ASGNRRRRAN PHGTLQSPDA PGDSNTNRFN GISTSLAADS TFSGIALEQP  480
QTTAAVPIGD HGLVSEMNGN HKLVVPCSSE HRMANAVLDV FEECLREAKA NGIFRGGNAK  540
GSASESELTK RWRAQRMDEL DVLNRRLRLL VEDTAAAGY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352841e-128BT035284.1 Zea mays full-length cDNA clone ZM_BFb0053D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.11e-136probable transcription factor At3g04930
RefseqXP_021307245.11e-136probable transcription factor At3g04930
TrEMBLB6T7U51e-135B6T7U5_MAIZE; Uncharacterized protein
STRINGSb01g010570.11e-135(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.12e-09DNA-binding storekeeper protein-related transcriptional regulator