Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 454aa    MW: 48895.8 Da    PI: 9.8869
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  + 169 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVANGLDPARLA 248
                                   79*******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+ 249 PHDRDVLHLCSRLWD 263
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-24170263IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352841e-146BT035284.1 Zea mays full-length cDNA clone ZM_BFb0053D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.11e-162probable transcription factor At3g04930
RefseqXP_021307245.11e-162probable transcription factor At3g04930
TrEMBLB6T7U51e-163B6T7U5_MAIZE; Uncharacterized protein
STRINGSb01g010570.11e-162(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.29e-10DNA-binding storekeeper protein-related transcriptional regulator