PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00013.1.g01610.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 348aa    MW: 37508.8 Da    PI: 8.7681
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00013.1.g01610.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP162.32.5e-50992551136
                           TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                                   aa +kdrhski+T++g+RdRR+Rls ++a++fF+Lqd+LGfdk+skt++WLl+ +k+ai+e++ +  +++sec ++sss s
  Zjn_sc00013.1.g01610.1.am.mk  99 AASRKDRHSKICTAGGMRDRRMRLSFDIARKFFALQDMLGFDKASKTVQWLLNTSKAAIQEIMTD--DASSECVDGSSSLS 177
                                   588**************************************************************..66666977777777 PP

                           TCP  82 as...nsssg.......................kaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                                   ++   n                           ka+++++++k+++ksa+++  l+ke+rakar+rarertrek+r+++++
  Zjn_sc00013.1.g01610.1.am.mk 178 VDgkhN---LteelgggdqqkkgngcsegkksaKARRETTTPKPPRKSANAHPVLDKETRAKARERARERTREKHRMRWVK 255
                                   763330...2456666677777789999999978888888**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.0E-45101251IPR005333Transcription factor, TCP
PROSITE profilePS5136934.558102160IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.54231248IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MPLYQQLQLS SPSPKPDQSS SSFYYYPCSP PFAAAADASS FDMSYQLDSA AATTPAPAVI  60
NSPELPMRPS MEQPPAPKHG PGNAQGAGGV SLDTASPAAA SRKDRHSKIC TAGGMRDRRM  120
RLSFDIARKF FALQDMLGFD KASKTVQWLL NTSKAAIQEI MTDDASSECV DGSSSLSVDG  180
KHNLTEELGG GDQQKKGNGC SEGKKSAKAR RETTTPKPPR KSANAHPVLD KETRAKARER  240
ARERTREKHR MRWVKLASAI DVEAAAGRDQ PNASNLNHSP SMNMASAAEL GERCSSTLNH  300
GGRTQEVSMP SEPNDMILAF GNGAYGGSNY CQEQWELGGV VFANSRFY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in apical dominance. Represses the growth of axillary organs (e.g. lateral branches), but enables the formation of female inflorescences. Regulates the number and length of axillary branches. {ECO:0000269|PubMed:12524360, ECO:0000269|PubMed:16642024, ECO:0000269|PubMed:17947410, ECO:0000269|PubMed:8536981, ECO:0000269|PubMed:9087405}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796975.11e-154transcription factor TEOSINTE BRANCHED 1-like
SwissprotQ93WI21e-131TB1_MAIZE; Transcription factor TEOSINTE BRANCHED 1
TrEMBLA0A346M1071e-179A0A346M107_CYNDA; Teosinte branched 1
STRINGPavir.Ia00838.1.p1e-156(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72533651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-25TCP domain protein 12
Publications ? help Back to Top
  1. Tenaillon MI, et al.
    Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.).
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(16): p. 9161-6
    [PMID:11470895]
  2. Clark RM,Tavaré S,Doebley J
    Estimating a nucleotide substitution rate for maize from polymorphism at a major domestication locus.
    Mol. Biol. Evol., 2005. 22(11): p. 2304-12
    [PMID:16079248]