PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00012.1.g07960.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 201aa    MW: 21933.9 Da    PI: 8.0163
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00012.1.g07960.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1284.9e-0975118851
                                   HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                                   rr+  NReA r++R++Kka  + Lee+vk+L a N++L  +l++
  Zjn_sc00012.1.g07960.1.am.mk  75 RRALGNREAVRKYREKKKAHEAFLEEEVKKLRATNQQLLRRLQN 118
                                   89999*********************************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-771135IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.44E-773119No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-1374136No hitNo description
PfamPF077162.9E-1374125IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.675117IPR004827Basic-leucine zipper domain
CDDcd146865.53E-1275125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MDSGGADLQS QLLFSYPEMP DSFDNFLNCS HRHGCDPPST SAAMHSHSCL HAHTQVIAVG  60
GVEDDEGGAE SSGPRRALGN REAVRKYREK KKAHEAFLEE EVKKLRATNQ QLLRRLQNHA  120
ALEAEAVRLR SLLLDVRGKI GAEVAGFPFP KQCGVDSGSA VGADPPALLI ELPYVTALKV  180
PAIINFLPLF KWRVAQRKSP S
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3548468e-49AK354846.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1012A02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.15e-65putative bZIP transcription factor superfamily protein
RefseqXP_008647614.11e-63PREDICTED: putative bZIP transcription factor superfamily protein isoform 1 isoform X1
SwissprotQ8GTS26e-42BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0A9S3G73e-66A0A0A9S3G7_ARUDO; Uncharacterized protein
STRINGGRMZM2G175870_P012e-64(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-39bZIP family protein