PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00012.1.g04390.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 393aa    MW: 42255.4 Da    PI: 8.2548
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00012.1.g04390.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49431682128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgy
  Zjn_sc00012.1.g04390.1.am.mk  43 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGY 122
                                   79***************************.99***************7767789*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zjn_sc00012.1.g04390.1.am.mk 123 WKATGADRMIRGEDNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 168
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5742192IPR003441NAC domain
PROSITE profilePS5100555.33642192IPR003441NAC domain
PfamPF023651.5E-2444168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSRDLEDGHG GAVAAGGGAG SSEASVGRGA GDGGDSHDND LVMPGFRFHP TEEELIEFYL  60
RRKVEGRRFN VDLIADLDLY RFDPWELPAM AVMGGKEWFF YVPRDRKYRN GDRPNRVTAS  120
GYWKATGADR MIRGEDNRPI GLKKTLVFYS GKAPKGVRSS WIMNEYRLPP PAADADPLTH  180
KSEISLCRVY KRSGIDDGHG QPSSSTQASS GRRTRTSRHM STSPASTPLS HIQHPGSFHL  240
LQGECSSVSP PTIMDPLLAA HNVPQLLQPP RPRALTGNSL AAGASVPTEG AAILASTYSL  300
LNMATVPMGS SRPVDELSTL VGHSQAYANH LSAATGSHFV LPLPSPQPTP QVAPLGALPI  360
AAPPLASVAD KLSWDWNPVP DTTARDYSNS SFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-564419319166NO APICAL MERISTEM PROTEIN
1ut4_B9e-564419319166NO APICAL MERISTEM PROTEIN
1ut7_A9e-564419319166NO APICAL MERISTEM PROTEIN
1ut7_B9e-564419319166NO APICAL MERISTEM PROTEIN
4dul_A9e-564419319166NAC domain-containing protein 19
4dul_B9e-564419319166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0604780.0BT060478.1 Zea mays full-length cDNA clone ZM_BFb0004F04 mRNA, complete cds.
GenBankHQ8587620.0HQ858762.1 Zea mays clone UT1609 NAC transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-170NAC domain-containing protein 35
TrEMBLK3Z6D41e-170K3Z6D4_SETIT; Uncharacterized protein
TrEMBLK3Z6L91e-171K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-170(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-89NAC domain containing protein 35