PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g11790.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family VOZ
Protein Properties Length: 228aa    MW: 26347.2 Da    PI: 5.7862
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g11790.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ246.35.4e-762114692217
                             VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhly 170
                                       elfdl ++ege+irewlffdkprraf+sgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhly
  Zjn_sc00009.1.g11790.1.sm.mkhc  21 DQELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLY 99 
                                     479**************************************************************************** PP

                             VOZ 171 eyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                     eyein++da+alyrle+k++d+kksak+k++++sl+++q++++rl+a
  Zjn_sc00009.1.g11790.1.sm.mkhc 100 EYEINDCDAFALYRLEFKSSDAKKSAKSKLACNSLNEIQQQMVRLSA 146
                                     *********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAQGFEFCPE YQTLPWTGEG DQELFDLYIF EGESIREWLF FDKPRRAFDS GNRKQRSLPD  60
YGGRGWHESR KQVMKDFGGL KRSYYMDPQP SSSYEWHLYE YEINDCDAFA LYRLEFKSSD  120
AKKSAKSKLA CNSLNEIQQQ MVRLSADGPV NAKRPSRSRI KSNPKDVNAN IYSVPNSTTQ  180
VNVPNAYQAV PQVDQMQFLN GDVVYGPHLP YGYSTERSDF YWNSNDGA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458501.21e-132transcription factor VOZ1
SwissprotQ9SGQ01e-61VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1E5VWW51e-132A0A1E5VWW5_9POAL; Transcription factor VOZ1
STRINGSb03g034810.11e-131(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-58vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]