PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g09350.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 468aa    MW: 50236.6 Da    PI: 9.2689
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g09350.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.12.2e-09194237851
                                   HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                                   r+   NReA rr+R++Kka  + Le +vk+L a N++L  +l+ 
  Zjn_sc00009.1.g09350.1.am.mk 194 RKPLGNREAVRRYREKKKAHAAFLEAEVKKLRATNQQLLWRLQG 237
                                   67778*********************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-9186254IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.7E-13191255No hitNo description
SuperFamilySSF579591.06E-6193238No hitNo description
CDDcd146863.03E-10194246No hitNo description
PfamPF077161.6E-11194243IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MVRLAFTARS VRRWSSADRF KYLGGGGSSD QDGGGGGGGW GFASWWRTGA RSALIEGAES  60
VRTQECWSGV GRVAIAPRNR TECLCPWTTW RSIRPCPAQG GVGVPLIPTV AVLRRGGERE  120
AVKEEGDSSG DRQQITHGFD ELLKTATACT HTHTCNPPGP SAALHTHTCL HAHLQVFASG  180
ETTTVDGDPR RAGRKPLGNR EAVRRYREKK KAHAAFLEAE VKKLRATNQQ LLWRLQGYVA  240
LEAEAARLRG LLFDVRGKID SEIDACELRK HCAVTSVVKC ADPPAPCLNT DDAELVAAPE  300
ESFVPTIADF EVDDGGVISR DLDAPDADSS TPVDVVASLP SARLIHASLA QQLRPNKRAA  360
GQSRIHLTPH GPTSPEPMTA KRVVRDGATP HQARPAPTLP TPSPGRSTSP RLPDSHSHSH  420
TPRARSGGAP CHAPSPITYP ISSSLPGARS KVLYRPPTQC SRSLVLLH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-21bZIP family protein