PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g05310.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 623aa    MW: 66793.7 Da    PI: 11.5693
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g05310.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.1e-13564614353
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                   + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Lea N  L  e ee  
  Zjn_sc00009.1.g05310.1.am.mk 564 AMQRQKRMIKNRESAARSRERKQAYIAELESIVTQLEADNAVLLREQEERH 614
                                   689*************************************98877766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-6562620IPR004827Basic-leucine zipper domain
PfamPF001702.1E-12564616IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117564612IPR004827Basic-leucine zipper domain
CDDcd147071.04E-16566616No hitNo description
SuperFamilySSF579592.11E-9566615No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-12567613No hitNo description
PROSITE patternPS000360569584IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MQPILAQNKP NDPNGPCCRD DVKSSSRSAD PENLSSMDLK TNSPIPSENE VDVPPSAPAA  60
AMPPFCCRTP KPASSQAAAA ASPFPSLPMR EDPATNRGAI SYRRRRVSIA PRRAAARARS  120
TCAAEKRSGG GAGRLRAVDG DGETADERLR RERRGKLGGP RQSPRPFHRR AAKLVARARL  180
FIGRSLISRT FSLAASWFAD AFLVAPRLRW ILDWTATAPR TRRAPRKPDA LRPPSHGRSR  240
PKEKKFQRRD VQMLLAAVQV WSDDPPQLNG PVASRIPCAG GPRCTTTRYP YYRVQATRHG  300
HGPARPMRAK RGAQSLAALQ HSAIPVRQSR PQSRLASFAR RLAKPPDEPG SESIASERAI  360
NSPTDTRTAR RGRGRGRGPA APASMASSRV MPTSSPSHTA SDLARLAQAA SEPGGGGGGG  420
LGSMNMEELL RGVYNDMSTP GPPPEPAGGG DRLISPAPAI GPRRTAEEVW KDITGRGGSA  480
GAAVPAAPAP VVVAGGGAGT TTEMTLEDFL AREGAVKEDE VGIPGPSAPV EGQVAMGFFS  540
GLETVTGSGR GRKRQLMDPV DSAAMQRQKR MIKNRESAAR SRERKQAYIA ELESIVTQLE  600
ADNAVLLREQ EERHKKRLKE VIF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147152RLRRER
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.14e-26G-box binding factor 4