PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g02230.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 207aa    MW: 21022.2 Da    PI: 5.9383
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g02230.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP80.54.6e-251622488
                             TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88
                                    ++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++++as+    +s+ s  +++++
  Zjn_sc00009.1.g02230.1.am.mkhc  1 MPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTIPASAL---ASVPSLPSPNAA 62
                                    9*********************************************9665...444444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.5E-201181IPR005333Transcription factor, TCP
PROSITE profilePS5136920.931139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MPALCAARIF QLTRELGHKS DGETVQWLLQ QAEPAIVAAT GTGTIPASAL ASVPSLPSPN  60
AALARPHHHH MWAPPAASAG FSSAGFLNSA AGGADAAGIG GLMQRMGLPA GLDMSGGGAA  120
GGHIGFAPMF AGHAAAGVPG LELGLSQDGH IGVLAPQSLS QFYHHVGAAG GSGQLQHPHQ  180
RHQHQHQQQE DGEDEREDAE SDEESGQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456872.14e-84transcription factor TCP20
SwissprotQ9LSD52e-34TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0A8YXQ04e-90A0A0A8YXQ0_ARUDO; Uncharacterized protein
STRINGSb03g044320.12e-83(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.15e-24TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]