PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g03110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 612aa    MW: 66364.5 Da    PI: 10.2217
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g03110.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.6e-23331374144
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                   d+epgrCrRtDGKkWRCs+++++++k+CE+H hrg++rsrk++e
  Zjn_sc00007.1.g03110.1.am.mk 331 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHKHRGKNRSRKPVE 374
                                   79***************************************998 PP

2QLQ60.83.7e-21260295237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ ++++
  Zjn_sc00007.1.g03110.1.am.mk 260 PFTATQWQELEHQALIYKCLASGMPIPSHLVPPLRR 295
                                   9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-11259295IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.9E-15260293IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.663260295IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.744331375IPR014977WRC domain
PfamPF088791.7E-18332374IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MSFRSESQSQ QQQTQKSTAA MPADFRDGPK SQKMSRTPDN RRFKFWAGGG LHSVRVHALV  60
GGCRPSAWCV SLPASTDAGP NGARFWVARC RVHVALCFAR AAPDGPIEWR QQGAKQPERA  120
GARQQGARAG GSWAPAVCVN RNRGKTTQWL GQVAGCSPKI SPPSPAPRTH ADAAPTDYKT  180
RPPCDHGHSA RRYATSSPLK KPASRPRGAP GTYSCGAGSV VLFIGSRSGK GSSFATQVTA  240
KMMMMTNREG GAGAAAGRYP FTATQWQELE HQALIYKCLA SGMPIPSHLV PPLRRILDSA  300
LATSPSLGFP PQPSLGWGCY GMAFGRKAHE DPEPGRCRRT DGKKWRCSKE AYPDSKYCEK  360
HKHRGKNRSR KPVEMSLAAP SASAASATTA TSSPAPSYHR PAPEAAPYTA LYGGSPYAAS  420
TRPVTGAYRA AQVSPFHIHL DTTYPHPPAS SYYSVDQRDY AYGHTAKDVG EHAFFSDGAA  480
ERDRHAAGQW QFRQLGMEPK PSATSLFPNG GYNNGTASAY AVDMTTKDDD ERRRQQQHCF  540
VLGADLRLER PSNHDVPEAQ KPLRPFFDEW PHEKSSKGSW MGLGGETQLS MAIPVAANDL  600
PVTSRYRKAF PA
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702921e-135EU970292.1 Zea mays clone 343148 atGRF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701613.10.0growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-160GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2T7FCW60.0A0A2T7FCW6_9POAL; Uncharacterized protein
STRINGSi017515m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-47growth-regulating factor 5