PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 112aa    MW: 11796.6 Da    PI: 12.2682
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasece 74
                                  +++ c a +F+L++eLG+++d++tieWLl+qa+p+i+ +tgt++++as ++  1 MPIICTAPVFQLTRELGHKSDGQTIEWLLRQAEPSIIVATGTGTTPASVST 51
                                  9*****************************************999995551 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136918.159139IPR017887Transcription factor TCP subgroup
PfamPF036347.8E-17156IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407986e-45AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047766e-45AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149586e-45AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126106e-45CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018436782.12e-26PREDICTED: transcription factor TCP7-like
TrEMBLA0A2U1L6V69e-25A0A2U1L6V6_ARTAN; Transcription factor, TCP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.15e-29TCP family protein