PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g08990.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LFY
Protein Properties Length: 494aa    MW: 53999.5 Da    PI: 9.1916
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g08990.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY270.18.2e-83803531280
                       FLO_LFY   1 mdpea.fsas.lfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvs 76 
                                   mdp++ fsa+  f+wd   p++aa +pp         ++++l    a  a++ releel+ +yGvr +tva+i elGft+s
  Zjn_sc00004.1.g08990.1.am.mk  80 MDPHDaFSAAhPFRWDlgpPAHAAPHPPPPP----PPPPPSLPFPLAPPANAPRELEELVAGYGVRPSTVARILELGFTAS 156
                                   676554876659****653322222222222....222233345567778889**************************** PP

                       FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqee 157
                                   tL++m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+        r      ++  ++da+sqe+ls+e++   
  Zjn_sc00004.1.g08990.1.am.mk 157 TLLGMTERELDDMMATLAGLFRWDVLLGERFGLRAALRAERARVVVLG---GRF-----QTGGTMDAASQEVLSDERDVA- 228
                                   *******************************************98854...454.....467789**********98855. PP

                       FLO_LFY 158 keaagsggeglgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse.....ededeeeeededeegsgedgeerqrehP 232
                                       +sgg    e++   a+ +k+ +++  ++k  k++rkk+ +         e +++    ++++e+s+ +g erqrehP
  Zjn_sc00004.1.g08990.1.am.mk 229 ----ASGGVADDETGRRLAAGRKQAKKEAATRKGkKARRKKELRPLDVledenEGDEDGGGASDSTESSAGGGGERQREHP 305
                                   ....4444443333333333322222222222221222222222222232222112222223334444667788******* PP

                       FLO_LFY 233 fivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                                   f+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptk
  Zjn_sc00004.1.g08990.1.am.mk 306 FVVTEPGEVARAKKNGLDYLFHLYEQCRVFLLQVQTIAKMAGHKSPTK 353
                                   ***********************************************9 PP

2FLO_LFY235.82.1e-72378484280386
                       FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfn 360
                                    vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+didavf+
  Zjn_sc00004.1.g08990.1.am.mk 378 HVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDIDAVFA 458
                                   6******************************************************************************** PP

                       FLO_LFY 361 ahprLsiWYvPtkLrqLChlerskas 386
                                   ahprLsiWYvPt+LrqLCh++r+ ++
  Zjn_sc00004.1.g08990.1.am.mk 459 AHPRLSIWYVPTRLRQLCHQARNGHA 484
                                   **********************9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.6E-18280484IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MRGCTSIIIG SPCLLFLYQH VVIGIRSTLA RASSHTGTVR PSETNERGFV KSTGCARPAV  60
RRTQQWPLYN EPSPPAKATM DPHDAFSAAH PFRWDLGPPA HAAPHPPPPP PPPPPSLPFP  120
LAPPANAPRE LEELVAGYGV RPSTVARILE LGFTASTLLG MTERELDDMM ATLAGLFRWD  180
VLLGERFGLR AALRAERARV VVLGGRFQTG GTMDAASQEV LSDERDVAAS GGVADDETGR  240
RLAAGRKQAK KEAATRKGKK ARRKKELRPL DVLEDENEGD EDGGGASDST ESSAGGGGER  300
QREHPFVVTE PGEVARAKKN GLDYLFHLYE QCRVFLLQVQ TIAKMAGHKS PTKRQIGMHD  360
LDALSDSVVL CASPTYPHVT NQVFRYAKKC GASYINKPKM RHYVHCYALH CLDEEASNAL  420
RRAYKARGEN VGAWRQACYA PLVEIAARHG FDIDAVFAAH PRLSIWYVPT RLRQLCHQAR  480
NGHATAGLPP PPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-942974812161PROTEIN LEAFY
2vy1_A1e-942974812161PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.10.0PREDICTED: probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC120.0K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-93floral meristem identity control protein LEAFY (LFY)