PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g08020.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 615aa    MW: 64502.1 Da    PI: 7.6075
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g08020.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.21.4e-962486152374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                   ++lL e+A a+++g++e a + La l+  a+p+gd  qRl+a+++ AL++r+a       ++ p+++ +e    e+ +  +
  Zjn_sc00004.1.g08020.1.sm.mk 248 RQLLSEAAVAIADGNFETAATQLAALKRAANPRGDVEQRLIAMMVAALSSRIAP-----TASAPAQHLAELCGLEQRNGSQ 323
                                   789**************************************************9.....4455666666566778888889 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeele 159
                                    +++ sP+++++  +aN aI+eav  ++++H++Dfd+s + Q +aL+q La+R+ +  sl++T+v +p+s     ++ +l 
  Zjn_sc00004.1.g08020.1.sm.mk 324 HLHDRSPCFRLALYAANVAIVEAVGDHRAIHVVDFDVSAP-QHAALIQYLADRRVPGTSLKVTAVTDPSSPftqsQTATLP 403
                                   9************************************987.99************************998889989999** PP

                          GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                   ++gerL+k+A++ g++ +f++ v+ r ++l+  +L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l ++vv+
  Zjn_sc00004.1.g08020.1.sm.mk 404 AVGERLKKLADRAGIEYHFKM-VSCRAAELDAAKLGLEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGAQVVT 483
                                   ********************9.7999******************************************************* PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   +veqe+++n++++++rf++a+ yy a++dsle++l+r+s er++ E + l++++ n+v  ega+r er+e ++kWr+r+++
  Zjn_sc00004.1.g08020.1.sm.mk 484 LVEQELNTNTAPLAARFTDACAYYGAILDSLEVTLGRDSAERAMAESA-LAKKAANAVGREGADRLERCEVFGKWRARFGM 563
                                   ***********************************************9.9******************************* PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   aGF+pv+ls ++a+q+ + +   + +g++++ e+g l lgW++r ++++SaWr
  Zjn_sc00004.1.g08020.1.sm.mk 564 AGFRPVALSPSIADQVVARVGPAP-QGFTMKPENGVLRLGWMGRVVTVASAWR 615
                                   ***********************9.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.149221596IPR005202Transcription factor GRAS
PfamPF035144.8E-94248615IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGLGS AMQIPMQQQR PDAVAAGGVL KRSLGELERW QHQQVAAQQA  60
LYLRAVRQRT AAAALLGGAP SHQPMVLPGS SYGGALASPS STLSSLTTAS GAAVPLMQPQ  120
MHRQVPLMAS SAQQTQALGV SRAPPPPPAS SSDMFLLQEL EKQLLGDDDE PVAAMSGTGS  180
AVTNSEWEET IQQLNSITAG ASPVVPAPVT PNNNAAGMTR SPSNSSSSTA SSSASCSPPT  240
PGAAAATRQL LSEAAVAIAD GNFETAATQL AALKRAANPR GDVEQRLIAM MVAALSSRIA  300
PTASAPAQHL AELCGLEQRN GSQHLHDRSP CFRLALYAAN VAIVEAVGDH RAIHVVDFDV  360
SAPQHAALIQ YLADRRVPGT SLKVTAVTDP SSPFTQSQTA TLPAVGERLK KLADRAGIEY  420
HFKMVSCRAA ELDAAKLGLE PGEALAVNLA FALSHVPDES VSPANPRDEL LRRVRALGAQ  480
VVTLVEQELN TNTAPLAARF TDACAYYGAI LDSLEVTLGR DSAERAMAES ALAKKAANAV  540
GREGADRLER CEVFGKWRAR FGMAGFRPVA LSPSIADQVV ARVGPAPQGF TMKPENGVLR  600
LGWMGRVVTV ASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4026661522375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-85SCARECROW-like 8