PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g09940.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 306aa    MW: 33667.9 Da    PI: 4.7052
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g09940.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.5e-1964117356
                                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++ +eq+++Le++Fe +++++ ++++ +A+ l L+ rqV vWFqNrRa++k
  Zjn_sc00003.1.g09940.1.sm.mkhc  64 KKRRLAQEQVRVLERCFETDNKLDPDRKACIARDLALQPRQVAVWFQNRRARWK 117
                                     456899***********************************************9 PP

2HD-ZIP_I/II125.32.8e-4063155193
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl++eqv++LE++Fe+++kL+p+rK+ +ar+L lqprqvavWFqnrRAR+ktk+lE+d++aL++++dal+++ ++
  Zjn_sc00003.1.g09940.1.sm.mkhc  63 EKKRRLAQEQVRVLERCFETDNKLDPDRKACIARDLALQPRQVAVWFQNRRARWKTKHLERDFAALRARHDALRADCDA 141
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L++++++L++e++e
  Zjn_sc00003.1.g09940.1.sm.mkhc 142 LRRDKDALAAEIRE 155
                                     *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-1856120IPR009057Homeodomain-like
SMARTSM003891.6E-1662123IPR001356Homeobox domain
PROSITE profilePS5007115.72663119IPR001356Homeobox domain
PfamPF000463.9E-1664117IPR001356Homeobox domain
CDDcd000866.67E-1564120No hitNo description
Gene3DG3DSA:1.10.10.604.5E-1970118IPR009057Homeodomain-like
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PfamPF021831.6E-14119160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MKRQSKQRLT SSRESTGTGE DLAFAEEENL TARNMEREET EMEDVDEDDD EPARGRSTCG  60
LGEKKRRLAQ EQVRVLERCF ETDNKLDPDR KACIARDLAL QPRQVAVWFQ NRRARWKTKH  120
LERDFAALRA RHDALRADCD ALRRDKDALA AEIRELRQKL PNPEPTVKVE ATGNDAAEDR  180
QGTVGASATA VYKDGSSESD SSVVFNDVEA SPYSGAVFEQ PPQSGGFVGF GGSLIDSAAA  240
TMACSFLPPF GTNWHHGSAT YPCHPYKGGG DSFGFTEEWL AGSDVISSDG VAGFFADDHA  300
SSFNFS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9647501e-143EU964750.1 Zea mays clone 281337 homeodomain-leucine zipper transcription factor TaHDZipI-1 mRNA, complete cds.
GenBankJX4699251e-143JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.11e-125homeobox-leucine zipper protein HOX13 isoform X2
SwissprotQ10QP32e-90HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-133A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGPavir.Ia04906.1.p1e-125(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.24e-26homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]