PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 438aa    MW: 48107.7 Da    PI: 5.3068
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv++Lt+ hvkSHLQkYR+ 230 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDDLTIFHVKSHLQKYRT 284
                                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.785227287IPR017930Myb domain
TIGRFAMsTIGR015571.2E-25230284IPR006447Myb domain, plants
PfamPF002498.5E-9232283IPR001005SANT/Myb domain
PfamPF143793.2E-24313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-30229288160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
TrEMBLA0A2S3IR130.0A0A2S3IR13_9POAL; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-65phosphate starvation response 1