PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g12150.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 309aa    MW: 34138.6 Da    PI: 4.576
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g12150.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-1960112456
                                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     ++++  eq+++Le+ Fe +++++  +++++A++lgL+ rqV vWFqNrRa++k
  Zjn_sc00002.1.g12150.1.sm.mkhc  60 KRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWK 112
                                     4467789*********************************************9 PP

2HD-ZIP_I/II129.11.8e-4158150193
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl+ eqv++LE+sFe+++kL+p rK+++areLglqprqvavWFqnrRAR+ktkqlE+d++aL++++d+l+++ ++
  Zjn_sc00002.1.g12150.1.sm.mkhc  58 EKKRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDSLRADCDA 136
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L++++++L++e++e
  Zjn_sc00002.1.g12150.1.sm.mkhc 137 LHRDKDALAAEIRE 150
                                     *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1856116IPR009057Homeodomain-like
SMARTSM003895.6E-1957118IPR001356Homeobox domain
PROSITE profilePS5007116.5258114IPR001356Homeobox domain
CDDcd000861.81E-1759115No hitNo description
PfamPF000464.3E-1660112IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1966113IPR009057Homeodomain-like
PRINTSPR000311.5E-58594IPR000047Helix-turn-helix motif
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PRINTSPR000311.5E-594110IPR000047Helix-turn-helix motif
PfamPF021832.9E-15114155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MKRPTSSHEP TEPGDKLPFP EEENLTARRM EQEETEMDDD EDELADGRAA RSACGLGEKK  60
RRLALEQVRA LERSFETDNK LDPGRKARIA RELGLQPRQV AVWFQNRRAR WKTKQLERDF  120
AALRARHDSL RADCDALHRD KDALAAEIRE LRQKLSKPEA AVKVEATCND AVEDRQAAFG  180
TSATIAVYKD GSSDSDSSVV FNDVEASPYS GAVLEQPPQQ AGFVGFGESF MDSSAAATMG  240
CPSFGTKWQH GSMTYPCDDP YKAGSYGIME EWLAGSDVIS NDGAAGFFSD EHAPSLNFSW  300
CASVAEGWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106114RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699251e-131JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.11e-126homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-102HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-142A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGPavir.Ia04906.1.p1e-129(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-43homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]