PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01038619001
Common NameVIT_16s0098g01170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 226aa    MW: 25216.7 Da    PI: 4.8737
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01038619001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.92.3e-202478256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       r++ +f++eq++ Le+ Fe+++++ a+++eeLA +lg++ rqV +WFqN+Ra++k
  GSVIVT01038619001 24 RNKKRFSDEQVQYLESIFESDSKLEARKKEELAVELGMQPRQVAIWFQNKRARWK 78
                       67889*************************************************9 PP

2HD-ZIP_I/II120.68.2e-3925116293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +k+r+s+eqv+ LE+ Fe+++kLe ++K+ela eLg+qprqva+WFqn+RAR+k+kq+E+dy+aL+++ydal+++ e+L++e+++L ++l++
  GSVIVT01038619001  25 NKKRFSDEQVQYLESIFESDSKLEARKKEELAVELGMQPRQVAIWFQNKRARWKSKQIEHDYKALRASYDALTSRFESLKEEKQSLLTQLQK 116
                        79*************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-20881IPR009057Homeodomain-like
SuperFamilySSF466895.56E-201681IPR009057Homeodomain-like
PROSITE profilePS5007118.2362080IPR001356Homeobox domain
SMARTSM003895.4E-202284IPR001356Homeobox domain
CDDcd000863.27E-172481No hitNo description
PfamPF000461.1E-172478IPR001356Homeobox domain
PRINTSPR000315.7E-65160IPR000047Helix-turn-helix motif
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
PRINTSPR000315.7E-66076IPR000047Helix-turn-helix motif
PfamPF021831.2E-1680121IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MESRGCSAEE AGEEGEQLTR KKSRNKKRFS DEQVQYLESI FESDSKLEAR KKEELAVELG  60
MQPRQVAIWF QNKRARWKSK QIEHDYKALR ASYDALTSRF ESLKEEKQSL LTQLQKLGDL  120
MEKPGDGVGS GFGGNSSTDG GSDTGDDAKL SYLEGGLDHR LVKCSDDDKS RSAGYFGHQE  180
GPELLDKCEN ADISLESTGK WFGFASGGFH DQSCTISQLW DFWSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.141620.0bud| flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4344490.0AM434449.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X031416.3, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271523.21e-163PREDICTED: homeobox-leucine zipper protein ATHB-12
TrEMBLE0CVA41e-162E0CVA4_VITVI; Uncharacterized protein
STRINGVIT_16s0098g01170.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.12e-45homeobox 12