PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01038591001
Common NameLOC100264143, VIT_16s0098g01420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 246aa    MW: 26813.7 Da    PI: 8.4513
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01038591001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.3e-403191262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  GSVIVT01038591001 31 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRST 91
                       7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-272383IPR003851Zinc finger, Dof-type
PfamPF027014.6E-343289IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2643589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDTAQWPQGI GVVKPMESSG PVAERRARPQ KDQALNCPRC NSTNTKFCYY NNYSLSQPRY  60
FCKTCRRYWT EGGSLRNVPV GGGSRKNKRS TSSSSSSSSP ASSKKLLPDH LITRFPSSAS  120
QNPKIHEGQD LNLAFPPPPE DYNNSISEFA DLGLGSFMPM SVSDSNSIYS SGFPLQEFKP  180
TLNFSLDGFQ SGYGSLQGVQ ESGARLLFPL EDLKQVSNTT EFEQSRGVQG DSAGYWNGML  240
GGGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.180930.0inflorescence| pedicel
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4861830.0AM486183.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X166878.4, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275610.11e-161PREDICTED: dof zinc finger protein DOF4.6 isoform X1
SwissprotQ8LAP82e-56DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A438BU511e-159A0A438BU51_VITVI; Dof zinc finger protein DOF4.6
TrEMBLF6H7D01e-159F6H7D0_VITVI; Uncharacterized protein
STRINGVIT_16s0098g01420.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-49Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]