PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036760001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family NF-YC
Protein Properties Length: 115aa    MW: 13151.8 Da    PI: 4.8367
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036760001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC43.37.9e-14135435
              NF-YC  4 sfwekq...iekatdfknhelPlarikkilkaded 35
                       +fw++q   ie++tdfknh+lPlarikki+kaded
  GSVIVT01036760001  1 MFWSNQmqeIEQTTDFKNHSLPLARIKKIMKADED 35
                       69**9988889***********************9 PP

2NF-YC42.61.3e-13346967102
              NF-YC  67 eenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                        e+nkrrtl+k+diaaa++rtd+fdflvdi+prdelk
  GSVIVT01036760001  34 EDNKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELK 69 
                        589******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.91E-13759IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.3E-81234IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.7E-103565IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MFWSNQMQEI EQTTDFKNHS LPLARIKKIM KADEDNKRRT LQKNDIAAAI SRTDVFDFLV  60
DIIPRDELKE EGLGAVVDQS SIYAAQQPRP PVPFMPWPQA QSQPQQPQQQ QTDT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13743RRTLQKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.30851e-64bud| fruit| inflorescence| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4419413e-62AM441941.2 Vitis vinifera contig VV78X036116.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645122.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645121.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645120.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645119.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645118.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645117.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_010645116.17e-50PREDICTED: nuclear transcription factor Y subunit C-2
RefseqXP_002262881.27e-50PREDICTED: nuclear transcription factor Y subunit C-2
SwissprotQ8LCG72e-41NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
TrEMBLA5B0078e-50A5B007_VITVI; Putative uncharacterized protein
STRINGVIT_19s0085g00520.t012e-49(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31517117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.21e-42nuclear factor Y, subunit C2