PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036581001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family NF-YC
Protein Properties Length: 272aa    MW: 30658.6 Da    PI: 9.9742
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036581001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC62.67.8e-206861898
              NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                       ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+    ++ +v+r ++fdfl div +
  GSVIVT01036581001  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYDITLQRGAKTMSSLHLKHCVQRHNVFDFLRDIVSK 86
                       5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.9E-26372IPR009072Histone-fold
SuperFamilySSF471131.22E-20488IPR009072Histone-fold
PfamPF008089.4E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YDITLQRGAK  60
TMSSLHLKHC VQRHNVFDFL RDIVSKVPDY GHADAAGDDR TMSKRRKAAG DEFNESDEET  120
KRSRMHEMSP VSSSGRGRGR GRGRGRGRGS RAIEREPVPH DVESDPCTSL PHSSKHDPNL  180
GRPIPNISES KELVKDNTAV SDGANPVVRN FDLNANVDED HQHQHQQQWM SVTHRQRLPL  240
RLNMKSILAG HFLKWTEWQL IQSSLHNSIL G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137147RGRGRGRGRGR
2139148RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.100791e-140bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4535681e-158AM453568.2 Vitis vinifera contig VV78X052634.12, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268063.11e-163PREDICTED: DNA polymerase epsilon subunit C
TrEMBLF6HV971e-163F6HV97_VITVI; Putative uncharacterized protein
STRINGVIT_13s0084g00040.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21791635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.18e-71nuclear factor Y, subunit C11