PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036449001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family TCP
Protein Properties Length: 274aa    MW: 31293.5 Da    PI: 10.0656
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036449001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP133.61.8e-41691922132
                TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaks 93 
                        a+kkdrhski T++g+R RRvRls+++a++fFdLqd+LGfdk+s t+eWLl ++k+aike ++ + s ++e+   +s ssas    + +  s
  GSVIVT01036449001  69 AVKKDRHSKITTAKGPRERRVRLSIKIARKFFDLQDMLGFDKASRTLEWLLMKSKTAIKEVVRMKHSCNEEA---KSLSSAS----ECEVVS 153
                        89**************************************************************55555333...2222222....234555 PP

                TCP  94 aakskksqksaasalnlakesrakarararertrekmri 132
                        +++   ++ ++++ l   kesrakarararertrekm+ 
  GSVIVT01036449001 154 EMNDAAESGDPQEILFRRKESRAKARARARERTREKMSS 192
                        6677777777887888999******************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-3770159IPR005333Transcription factor, TCP
PROSITE profilePS5136932.84771129IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137012.483172189IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MHPVPTSIPS PPQMFSSSNS GNPFQHLPSL FHQSPPFVGH ESDDIFLHHH NDLLVDYYGP  60
SNFLPGKRAV KKDRHSKITT AKGPRERRVR LSIKIARKFF DLQDMLGFDK ASRTLEWLLM  120
KSKTAIKEVV RMKHSCNEEA KSLSSASECE VVSEMNDAAE SGDPQEILFR RKESRAKARA  180
RARERTREKM SSLEESSSRP LANHTQREDI IEESIVIKRK LKPNSYFPHP PQNWDINTPS  240
ARSSFCAMTN MNLSTEFQVF GKPWEAYNNL SLR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.292140.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4641580.0AM464158.1 Vitis vinifera contig VV78X120795.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010660504.11e-104PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A438EB131e-103A0A438EB13_VITVI; Transcription factor CYCLOIDEA
TrEMBLA0A438JC241e-103A0A438JC24_VITVI; Transcription factor CYCLOIDEA
STRINGVIT_14s0083g00150.t012e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-30TCP family protein