PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035465001
Common NameVIT_04s0008g01850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Trihelix
Protein Properties Length: 514aa    MW: 58245.7 Da    PI: 6.9681
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035465001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix47.93.4e-15447495149
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkq 49 
                        rW+k ev+aLi++r+++e+r+++  lk+plWee+s+ m + g++rs+k+
  GSVIVT01035465001 447 RWPKAEVQALIQVRSRLESRFQEPGLKGPLWEEISSSMTSMGYQRSAKR 495
                        8**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.5E-8446494No hitNo description
CDDcd122031.52E-17447495No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MEGDSCSSLF SISTPQKQNQ HHHLHYQHHH HHHHLPPPPP PHQQQKHERQ QQQQQFFQLH  60
PVPFTQQLLQ QQHQFEVFQL QQQQQQQQRR LHQQLRLENE LGRNGGGGGE GVGNGGGGEG  120
GSASLPFFNF KLGLNENSGN REVVMNEEDK EEDGLIGGSE EHIPGNRPNS LEMPQCCWQS  180
QGDGTIKEPF WKPLNAQLFN KNDKETNEDE EKKEEGEGNK KINHGQVLDN DGGKNLGNKY  240
RFFGELEAIC SGAGLGETNQ TGSGSALTGE NMTRNAGLLR PLADPHCSNL GGAAAAIGVD  300
HGSETSIGEE AALRKLQKRK RRRKMKEELN SMAGFFESLV KQLMDHQEGL YRKFLEVVER  360
IDQERMEREE AWRSKQLENF NREAAARAHE QTLASSREVA VVSYLEKITG QSIDLPNKNN  420
TQLHSQRYLP KEPVKINNFS SSNTNSRWPK AEVQALIQVR SRLESRFQEP GLKGPLWEEI  480
SSSMTSMGYQ RSAKRSFLFY LFQFLAIIIH FFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1316322QKRKRRR
2317322KRKRRR
3317323KRKRRRK
4318322RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4246750.0AM424675.2 Vitis vinifera contig VV78X269243.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279929.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLF6H3S30.0F6H3S3_VITVI; Uncharacterized protein
STRINGVIT_04s0008g01850.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.28e-36Trihelix family protein