PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035363001
Common NameLOC100242268, VIT_04s0008g00900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 212aa    MW: 23192.2 Da    PI: 10.701
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035363001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-13107151347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ + ++lG g+W+ I+r + ++Rt+ q+ s+ qky
  GSVIVT01035363001 107 PWTEEEHRTFLLGLEKLGRGDWRGISRNFVTTRTPTQVASHAQKY 151
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.103.7E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.555100156IPR017930Myb domain
SuperFamilySSF466894.64E-18101157IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-19103155IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11104150IPR009057Homeodomain-like
SMARTSM007171.4E-10104154IPR001005SANT/Myb domain
CDDcd001679.01E-10107152No hitNo description
PfamPF002494.3E-11107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT LRGSSGVSSS SLTGGVKLFG VQLEMPSTTP LPMKKSFSLD  60
CLPSSSSTPS SSTSSRVSAD ENSDKFSRGY LSDGLIARTQ ERKKGVPWTE EEHRTFLLGL  120
EKLGRGDWRG ISRNFVTTRT PTQVASHAQK YFLRQSSLNK KKRRPSLFDL VESSKFSFHL  180
VNPSIPQPNQ PSIPCGFSLK TTNSTLLDLN F*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159163KKKRR
2159164KKKRRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.232890.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3828370.0FQ382837.1 Vitis vinifera clone SS0ABG41YI21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277676.11e-153PREDICTED: transcription factor MYB1R1
SwissprotQ7XC572e-51MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLD7STN21e-151D7STN2_VITVI; Uncharacterized protein
STRINGVIT_04s0008g00900.t011e-152(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-56MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]