PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035238001
Common NameLOC100254711, VIT_04s0079g00480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 715aa    MW: 78786.1 Da    PI: 6.2897
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035238001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-192478256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +   ++t++q+++Le++F+ +++p++++r++L ++lgL+ rq+k+WFqN+R++ k
  GSVIVT01035238001 24 KVYNRHTPQQIQRLEAFFKDCPHPDEAQRRQLGRELGLESRQIKFWFQNKRTQTK 78
                       667789**********************************************988 PP

2START144.69.1e-462294503206
                        HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEE CS
              START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakaetl 82 
                        a  a++el++++  +ep+Wvks+      +  d + ++f+++        ++e +++s+vv m+ ++lv+ +ld ++    + + ++ka+t+
  GSVIVT01035238001 229 AAGAMDELIRLVRINEPLWVKSAtnekYVLHHDSYERIFPKATHfkssnARIESSKESVVVAMNGMQLVNMFLDPNKyvdLFPTIVTKASTI 320
                        6679*******************333222333555555554443999999**************************88888888888***** PP

                        EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
              START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                        +v++ g      g lqlm+ ++  lsplv+ R+f+f+Ry++q + g+wv vdvS d  ++   ++++ R  +lpSg++i+++++g skvtwv
  GSVIVT01035238001 321 QVLEAGiigsrsGSLQLMYEQMHILSPLVApREFYFLRYCQQIELGVWVMVDVSYDYSKDG--QPNSLRFWKLPSGCMIQDLPDGCSKVTWV 410
                        *****************************99**************************9998..58*************************** PP

                        E-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 168 ehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        ehv++++++  h l+r lv+ +la+ga ++v tlqr ce+
  GSVIVT01035238001 411 EHVEVDDKSLtHRLYRDLVSGSLAFGAERMVGTLQRMCER 450
                        ******99988***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-21874IPR009057Homeodomain-like
SuperFamilySSF466891.21E-18980IPR009057Homeodomain-like
PROSITE profilePS5007117.0542080IPR001356Homeobox domain
CDDcd000861.96E-172081No hitNo description
SMARTSM003891.0E-172284IPR001356Homeobox domain
PfamPF000467.4E-172478IPR001356Homeobox domain
PROSITE profilePS5084841.731218453IPR002913START domain
SuperFamilySSF559614.67E-32219452No hitNo description
CDDcd088756.36E-105222449No hitNo description
SMARTSM002342.5E-33227450IPR002913START domain
PfamPF018525.3E-39230450IPR002913START domain
Gene3DG3DSA:3.30.530.202.2E-9321415IPR023393START-like domain
SuperFamilySSF559613.16E-14469699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0025501developmental stagefruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MEFRTGGNGS GGDQDGPNPR RGRKVYNRHT PQQIQRLEAF FKDCPHPDEA QRRQLGRELG  60
LESRQIKFWF QNKRTQTKTQ HERADNTALR AENERIQCEN LAIREALKNV ICPSCGGPPF  120
GEEERQRNIE KLQLENAQLK EEHEKVSNLL AKYIGKPITQ MHLLPPALGS SLDFSPGSFP  180
SQETGGLSIP TVGPALGLEL APVDVCNASV MYQFKGFPDM EKTLMTETAA GAMDELIRLV  240
RINEPLWVKS ATNEKYVLHH DSYERIFPKA THFKSSNARI ESSKESVVVA MNGMQLVNMF  300
LDPNKYVDLF PTIVTKASTI QVLEAGIIGS RSGSLQLMYE QMHILSPLVA PREFYFLRYC  360
QQIELGVWVM VDVSYDYSKD GQPNSLRFWK LPSGCMIQDL PDGCSKVTWV EHVEVDDKSL  420
THRLYRDLVS GSLAFGAERM VGTLQRMCER LAYLADENTP TRDLAGVISL PEGRRSIMKL  480
GHRMVKDFCG VLSMSGKLDF PQLSEVDTSG VRVSVRKSTE PGQPGGLIVS AATSLWLPMQ  540
CQTIFDFIRD EKMRPQWDVL SSGNPVHEIA HIANGVNPGN CTSIIRPFVP TENNMLMLQE  600
SCVEPLGGLV VYAPIDIPAI NVAIRGEESG NIPILPSGFI VSGDGRSDSG AGCTSDGNIM  660
GSGGSLLTVA FQVLVCGPAA PQQQLNMESV ATVNTLISST VQKIKIALNC SGLD*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4452770.0AM445277.2 Vitis vinifera contig VV78X256089.20, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268272.10.0PREDICTED: homeobox-leucine zipper protein ROC8
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLD7TA280.0D7TA28_VITVI; Uncharacterized protein
STRINGVIT_04s0079g00480.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11