PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035231001
Common NameVIT_04s0079g00410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB_related
Protein Properties Length: 480aa    MW: 53339.5 Da    PI: 6.7971
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035231001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1660104147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  GSVIVT01035231001  60 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1654108IPR009057Homeodomain-like
PROSITE profilePS5129421.47655109IPR017930Myb domain
TIGRFAMsTIGR015575.6E-1758107IPR006447Myb domain, plants
SMARTSM007172.5E-1359107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-960100IPR009057Homeodomain-like
PfamPF002495.6E-1460103IPR001005SANT/Myb domain
CDDcd001671.52E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MTVEDQSGGS RSNTFLSAGN LISLDAGTHS LTAAELKEQF SCRDDLAPKA RKPYTITKQR  60
ERWTEEEHKK FLEALKLYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVVR ETSGGNTNSA  120
EPIEIPPPRP KRKPVHPYPR KLVHPLRKGI SVLEPPVRSV SPNFSASEQE NQSPTSVLSA  180
VGSETLGSTL SNTQNGSPSP VSSAAGVNPD RMFLPELNPP TEENASPSPV LTTSSSVPDE  240
PLPMKFELFP QEIFAKECSV EEASTRTLKL FGRTVLVTDS HRPSSPTTSK SQPSDINNEG  300
MHVETLPWNS TPTESSPENS SFSWSHLQPQ PSGAFYYMHF QKEDSNCVEA GTTAPLPWWT  360
FYGGIPIPFL PLHHQDSIKA HEDTKFAETH DKEIQKEGSW TGSNTGSSHQ PYLDTMEKES  420
DSAFELKLSE RSAFSRGRTN TDKCVKGFMP YKRCLAERDT QSSIIIGNER EEQRIRLCL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.84290.0bud| flower| inflorescence| leaf| pedicel
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3821520.0FQ382152.1 Vitis vinifera clone SS0ABG69YH11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267976.20.0PREDICTED: protein REVEILLE 1
TrEMBLD7TA250.0D7TA25_VITVI; Uncharacterized protein
STRINGVIT_04s0079g00410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.15e-60MYB_related family protein