PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01034878001
Common NameVIT_18s0076g00200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 327aa    MW: 37138.3 Da    PI: 6.0111
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01034878001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS231.93e-71242921278
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lLl  A+av++++ + a + L +l + +  +gd++qR++ayf+ +Laa+l+   s  y+ +  ++t+    +ee+ a++ ++ vsP+++
  GSVIVT01034878001  24 LIHLLLITATAVDENNVSVAAENLRELYQSVCLNGDSVQRVVAYFADGLAAKLLTRKSPFYDMIMKEPTP----EEEFLAHTDLYRVSPYYQ 111
                        689****************************************************9*****999888887....677788888********* PP

               GRAS  93 fshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpf 176
                        f+h+taNqaI ea+e+e     +++H++Dfd+s+G+QWp+L+q+La+++  ++  slRiTg+g+    s +el+et+ rL +f +++ ++ f
  GSVIVT01034878001 112 FAHFTANQAIIEAFEEEeennnRALHVVDFDVSYGFQWPSLIQSLAEKAtsGNRISLRITGFGR----SLDELQETETRLISFSKAFrNLVF 199
                        ***************9988877889**********************99755566*********....9****************9857*** PP

               GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                        ef+ l    l   +l +Lr k++E++a nlv++l +l  + +++    +e+Lk v sl+P +v++veqe +++ +sFl rf+e+l+y++a+f
  GSVIVT01034878001 200 EFQGL----LRGSKLTNLRKKKNETVAANLVFHLNTLT-SFLKI----SETLKSVHSLNPSIVILVEQEGSRSPQSFLSRFMESLHYFAAMF 282
                        ****8....7777889*******************997.44444....56****************************************** PP

               GRAS 269 dsleaklpre 278
                        dsl+  lp e
  GSVIVT01034878001 283 DSLDDCLPLE 292
                        ***9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.831326IPR005202Transcription factor GRAS
PfamPF035141.0E-6824292IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0007016developmental stagewhole plant flowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MREQMLKLDH KRKGVVEDGK GLHLIHLLLI TATAVDENNV SVAAENLREL YQSVCLNGDS  60
VQRVVAYFAD GLAAKLLTRK SPFYDMIMKE PTPEEEFLAH TDLYRVSPYY QFAHFTANQA  120
IIEAFEEEEE NNNRALHVVD FDVSYGFQWP SLIQSLAEKA TSGNRISLRI TGFGRSLDEL  180
QETETRLISF SKAFRNLVFE FQGLLRGSKL TNLRKKKNET VAANLVFHLN TLTSFLKISE  240
TLKSVHSLNP SIVILVEQEG SRSPQSFLSR FMESLHYFAA MFDSLDDCLP LEKSGGFRVF  300
ERDDERAISL GWQDRCLITA SAWHCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-26292868270GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4801510.0AM480151.2 Vitis vinifera contig VV78X022813.7, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266212.10.0PREDICTED: scarecrow-like protein 21
TrEMBLD7SSA30.0D7SSA3_VITVI; Putative uncharacterized protein
STRINGVIT_18s0076g00200.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.15e-38SCARECROW-like 21