PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01034523001
Common NameVIT_18s0072g00670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Trihelix
Protein Properties Length: 541aa    MW: 62109.9 Da    PI: 7.8908
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01034523001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix667.8e-211691787
           trihelix 17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
                       m+ ++r+++lk+plWeevs+k++e g++rs+k+Ckek+en+ k+++++keg+ ++   + +t+++fdqlea
  GSVIVT01034523001  1 MDVTFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKYHRRTKEGRASK--ADGKTYRFFDQLEA 69
                       67799************************************************96..66678*******85 PP

2trihelix105.73.3e-33284369187
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        rW+k ev+aLi++r++++ +++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  GSVIVT01034523001 284 RWPKAEVQALIRLRTSLDVKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 369
                        8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.14E-14149No hitNo description
PfamPF138376.5E-14470No hitNo description
PROSITE profilePS500905.1691542IPR017877Myb-like domain
SMARTSM007173.1E-4281343IPR001005SANT/Myb domain
CDDcd122034.14E-27283348No hitNo description
Gene3DG3DSA:1.10.10.603.1E-4283340IPR009057Homeodomain-like
PfamPF138371.5E-22283370No hitNo description
PROSITE profilePS500907.259283341IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MDVTFRDSSL KGPLWEEVSR KLAELGYHRS AKKCKEKFEN VFKYHRRTKE GRASKADGKT  60
YRFFDQLEAL ETQPSLASLP HSKPPAPAVL AATMPLANLP TTLPEITVPS TLPNPTNSTA  120
NPTIPTIPSP TPPTSRHPPH NNVPTAHPAM AANFLSNSTS SSTSSDEELE RRGKRKRKWK  180
AFFQRLMKDV IERQEELQKR FLEAIEKREH DRMVREEAWK MQEMARMNRE HELLVQERSI  240
AAAKDAAVIA FLQKISEQQN PVLEPRKMDN GGGAENLVPT SSSRWPKAEV QALIRLRTSL  300
DVKYQENGPK GPLWEEISAG MRKLGYNRNA KRCKEKWENI NKYFKKVKES NKKRPEDSKT  360
CPYFHQLEAL YKEKNKMEIN SFNPSYPLLK PENPMVPIMV QPEQQWPLHP EMNRSESGME  420
DMESENNMEQ NQEDDEDDGE EEQEGDEDDE DDGGGYEIRV WHLTGRAVAN GNGSGSDRRS  480
CRREDEWVRF RLARWGCSKN FKKKNLYFRE EDGKKNKHMG CSLYNGLMGE GAEMGEMKEP  540
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.121120.0fruit| inflorescence
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4334760.0AM433476.2 Vitis vinifera contig VV78X257449.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266195.10.0PREDICTED: trihelix transcription factor GT-2
SwissprotQ391171e-130TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLF6GY300.0F6GY30_VITVI; Uncharacterized protein
STRINGVIT_18s0072g00670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-93Trihelix family protein