PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01034189001
Common NameVIT_08s0007g00180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 324aa    MW: 34464.6 Da    PI: 9.2277
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01034189001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-3969128362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  GSVIVT01034189001  69 EAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 128
                        6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3152117IPR003851Zinc finger, Dof-type
PfamPF027016.9E-3371126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60972126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVFSSMPSYL DPANWQQPHN HEAGSSGLPN QPPPPPPPPP QPHGGGGTGS IRPGSMADRA  60
RLANIPLPEA ALKCPRCEST NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG ALRNVPVGGG  120
CRRNKRSKGS SSKSPVSGDR QAGSSSTGAI HSNCSTAEIL GLAPQIPPMR FMAPLHHLAD  180
YGAGDIGLNY SGIPTAVGGT GDMNFQIGSL EQWRLQQTQQ FPFLGGLDPP PGLYPLEGGV  240
EPSNYVGGSS QVRPKLTGSG LSQVASVKME DNHEMNVARQ FLGIPGNDQY WGGNAWTDLA  300
SFSSSSTTET SGVGRNRKLQ LTM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4558240.0AM455824.2 Vitis vinifera contig VV78X138031.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270031.10.0PREDICTED: dof zinc finger protein DOF5.1
TrEMBLF6HLD40.0F6HLD4_VITVI; Uncharacterized protein
STRINGVIT_08s0007g00180.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.15e-48OBF-binding protein 3