PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01033481001
Common NameLOC100265773, VIT_08s0007g06670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 251aa    MW: 27739.2 Da    PI: 9.3451
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01033481001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.1e-1893147256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSVIVT01033481001  93 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 147
                        778899***********************************************98 PP

2HD-ZIP_I/II128.82.3e-4193183192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  GSVIVT01033481001  93 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 183
                        69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.13E-1882150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-1784150IPR009057Homeodomain-like
PROSITE profilePS5007117.21689149IPR001356Homeobox domain
SMARTSM003897.3E-1691153IPR001356Homeobox domain
PfamPF000462.6E-1593147IPR001356Homeobox domain
CDDcd000861.62E-1593150No hitNo description
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
SMARTSM003404.5E-26149192IPR003106Leucine zipper, homeobox-associated
PfamPF021834.5E-11149183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGLGTGIIGK GQGHGGEEDE RKVSSDPPVQ LDLLPFSPVP RHHPSSQLRF PWLADNLMSE  60
PGSSDGSGRA LDVNRFPVAT SRASDDDENG STRKKLRLSK EQSAFLEESF KEHNTLNPKQ  120
KLALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCETLTEENR RLQKELQELR  180
ALKTSQPFYM QLPATTLTMC PSCERVATTS TSSSAAAAAP TSTSATLART RLFPFSQAHV  240
HQAPAHQAAS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19197TRKKLRL
2141149RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.291980.0root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4847201e-179AM484720.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X012396.11, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275747.11e-160PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466654e-81HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A438D5N71e-159A0A438D5N7_VITVI; Homeobox-leucine zipper protein HAT14
TrEMBLF6HLH91e-159F6HLH9_VITVI; Uncharacterized protein
STRINGVIT_08s0007g06670.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-66homeobox from Arabidopsis thaliana