PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01032592001
Common NameVIT_14s0066g02460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 244aa    MW: 27824 Da    PI: 8.8496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01032592001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.94.5e-4010108199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC+++C+lapyfpa++pk f+n+h+lFG+sn++k+lk++++++++dam+s++ye+++r+r Pv+G++g+i++l qq++q+  
  GSVIVT01032592001  10 ACAACKYQRRKCSDQCPLAPYFPASNPKLFQNAHRLFGVSNMMKILKKVNDDQKHDAMQSIIYESNMRQRFPVHGCCGIIRQLYQQVQQTMD 101
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        el ++++
  GSVIVT01032592001 102 ELCHVNA 108
                        *998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.349110IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-3810106IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0007016developmental stagewhole plant flowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MTVKGGTSQA CAACKYQRRK CSDQCPLAPY FPASNPKLFQ NAHRLFGVSN MMKILKKVND  60
DQKHDAMQSI IYESNMRQRF PVHGCCGIIR QLYQQVQQTM DELCHVNARL HMIREQQFHC  120
QNNNNNLPLP PTPSQHLQQP MIGSNIIPVY PYQFDQQHHH PPPPPVLRTP VAHVGPSNQL  180
LTKENKGSHV EINKKTERLL WGQPDFDNIN GNSLMACLLQ FFTSQVPFLL QMGVPQHMIS  240
YNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2461037104LOB family transfactor Ramosa2.1
5ly0_B1e-2461037104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4613210.0AM461321.2 Vitis vinifera contig VV78X198049.32, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661022.21e-157PREDICTED: LOB domain-containing protein 27
TrEMBLA0A438CL660.0A0A438CL66_VITVI; LOB domain-containing protein 27
STRINGVIT_14s0066g02460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-44LOB domain-containing protein 27