PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01032491001
Common NameLOC100257769, VIT_14s0066g01440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 258aa    MW: 29232.6 Da    PI: 4.439
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01032491001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.9e-2149102356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  GSVIVT01032491001  49 KKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 102
                        5678*************************************************9 PP

2HD-ZIP_I/II1352.5e-4348139192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l++e +++ ke+e+L++e+ 
  GSVIVT01032491001  48 EKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSYDSLVSEYDSILKEKEKLKSEVV 139
                        69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-2036106IPR009057Homeodomain-like
PROSITE profilePS5007118.17244104IPR001356Homeobox domain
SMARTSM003893.3E-2047108IPR001356Homeobox domain
CDDcd000862.70E-1949105No hitNo description
PfamPF000463.6E-1849102IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-2250111IPR009057Homeodomain-like
PRINTSPR000313.7E-67584IPR000047Helix-turn-helix motif
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PRINTSPR000313.7E-684100IPR000047Helix-turn-helix motif
PfamPF021831.2E-17104146IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MLFLGNGDSL FRGPRSIMNI EETSKKRPFF TSPEDMFDEE YYDEQMPEKK RRLTPEQVHL  60
LEKSFEAENK LEPERKTQLA KKLGLQPRQV AVWFQNRRAR WKTKQLERDY DLLKSSYDSL  120
VSEYDSILKE KEKLKSEVVS LTEKLQAKEV TGTPTLTVQK VEPLQADAAD VPPVPCSVKV  180
EDRLSSGSGA SAVVDEDGPQ LLDSGDSYFQ NAEYPGCLGV QSEEDDGSDD GQSYFSDALV  240
LPEHHHEEGE ALLWVWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196104RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.171750.0fruit| inflorescence
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3943730.0FQ394373.1 Vitis vinifera clone SS0AFA21YB18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278872.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022833e-93HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLF6HV020.0F6HV02_VITVI; Uncharacterized protein
STRINGVIT_14s0066g01440.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-84homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]