PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01032415001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family LBD
Protein Properties Length: 202aa    MW: 22072 Da    PI: 8.3647
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01032415001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.4e-4341139199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++
  GSVIVT01032415001  41 PCAACKLLRRKCMPGCIFAPYFPPEEPQKFINVHKIFGASNVSKLLNEILPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVLRLQK 132
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        el+++++
  GSVIVT01032415001 133 ELDATNA 139
                        **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.29540141IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4241138IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MELIVLPTLD YFYSSTNLER DHTRGKRKVL KMASSSYSNS PCAACKLLRR KCMPGCIFAP  60
YFPPEEPQKF INVHKIFGAS NVSKLLNEIL PHQREDAVNS LAYEAEARMK DPVYGCVGAI  120
SVLQRQVLRL QKELDATNAD LIRFTCNDMS SSLSGPGSSQ FGRRMSHGGG GGGASFNQNS  180
GLPPPYPSPW DNNPSGDSHE S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-65381498119LOB family transfactor Ramosa2.1
5ly0_B4e-65381498119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4550060.0AM455006.1 Vitis vinifera contig VV78X258680.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273053.11e-125PREDICTED: LOB domain-containing protein 25
RefseqXP_010660868.11e-125PREDICTED: LOB domain-containing protein 25
SwissprotQ9FML41e-66LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A438JI691e-125A0A438JI69_VITVI; Protein lateral organ boundaries
STRINGVIT_14s0066g00680.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-69LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]