PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01031841001
Common NameLOC104878796, VIT_03s0063g01350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family Dof
Protein Properties Length: 174aa    MW: 18977 Da    PI: 8.2376
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01031841001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof105.23.7e-332175357
             zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
                       +++l+cprC+stntkfCyynny+lsqPr+fCk+CrryWt+GGalr++P    + k
  GSVIVT01031841001 21 HHHLQCPRCNSTNTKFCYYNNYNLSQPRHFCKSCRRYWTHGGALRDIPARDNAPK 75
                       57899*******************************************8655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-292376IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-202469IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.6362478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MQSEPGNHQR PTGPPPPPEN HHHLQCPRCN STNTKFCYYN NYNLSQPRHF CKSCRRYWTH  60
GGALRDIPAR DNAPKRSRSR SSPVTPPLAS YPPQRVPPDL NVGASGSFTR LLNSHGSEFS  120
GLGAEYGLGS GLHEVGDGGA WQIGIGEEVE LVEGNGFTWP DIHVSAPGRI LKE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17479KRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4411810.0AM441181.2 Vitis vinifera contig VV78X056020.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010647796.11e-126PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLD7TPS01e-125D7TPS0_VITVI; Uncharacterized protein
STRINGVIT_03s0063g01350.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-28Dof family protein