PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01030652001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 357aa    MW: 40852.8 Da    PI: 7.7029
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01030652001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS137.31.6e-42101290185373
               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         l+ l+ ++L+++ +Eal+Vn++  l +l+d++   ++    rd++L+++k+l+P+++vvv+++ad++++s+  r++ +++y++  fd+le+
  GSVIVT01030652001 101 LLNHLNASMLDLRDDEALVVNCQNWLRYLPDDQKGRAQnvsLRDTFLEVIKGLNPRILVVVDEDADLGASSLTSRITTCFNYFWIPFDALET 192
                        57899*************************998766555669************************************************** PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                         lp+++++ri +E+  +g +i+++++ eg +r+er e+  k ++r++++GF ++p+ e+++ ++k ll +++  g+ ++ e++ lvl+Wk++
  GSVIVT01030652001 193 FLPKDNHQRIEYEAD-IGHKIEDIITYEGLQRIERLESGPKLSQRMKSSGFLSIPFCEETVREVKFLLDEHA-SGWGMKREEDMLVLTWKGH 282
                        ***************.********************************************************.889999999********** PP

               GRAS 366 pLvsvSaW 373
                        + ++++aW
  GSVIVT01030652001 283 NSIFATAW 290
                        ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098516.8641272IPR005202Transcription factor GRAS
PfamPF035145.6E-40101290IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MAEATKYYMY QIVPYLMQFK GAQEFTSWIS ASLTVCSGLL SSTRWQRGLR GLLRSESLYR  60
LSGHRSLLYL MCRVKKSASV WRISLSSGMS LLNSILYSES LLNHLNASML DLRDDEALVV  120
NCQNWLRYLP DDQKGRAQNV SLRDTFLEVI KGLNPRILVV VDEDADLGAS SLTSRITTCF  180
NYFWIPFDAL ETFLPKDNHQ RIEYEADIGH KIEDIITYEG LQRIERLESG PKLSQRMKSS  240
GFLSIPFCEE TVREVKFLLD EHASGWGMKR EEDMLVLTWK GHNSIFATAW FPSKERNCTY  300
LLCMRQKLSL CFWKSESNPL ALISLNHTSY CSNSPSPPYS FPTSNNLLNT GKFGFE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4288330.0AM428833.2 Vitis vinifera contig VV78X040611.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275420.11e-143PREDICTED: scarecrow-like protein 32
TrEMBLF6HIM61e-143F6HIM6_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02770.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-51GRAS family protein