PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01030628001
Common NameVIT_12s0059g02500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CO-like
Protein Properties Length: 339aa    MW: 37064.8 Da    PI: 7.645
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01030628001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.54.2e-06235336
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                       e++C+ ++  ++  +C+++   lC  C  + H+ 
  GSVIVT01030628001  2 EPICEFCGVVRAVVYCKSDAARLCLHCDNSVHSA 35
                       689******99*******************9954 PP

2CCT61.72.4e-21282325144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R++a++RY+eK+ktR F K+irY+sRKa+A++R+Rv+GrFvk+ 
  GSVIVT01030628001 282 RDKAKMRYNEKKKTRTFGKQIRYASRKARADTRKRVRGRFVKAG 325
                        899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.958147IPR000315B-box-type zinc finger
SMARTSM003363.3E-7147IPR000315B-box-type zinc finger
CDDcd000211.83E-4335No hitNo description
PfamPF062033.4E-16282324IPR010402CCT domain
PROSITE profilePS5101714.684282324IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEPICEFCGV VRAVVYCKSD AARLCLHCDN SVHSANALSR RHLRSLLCDK CNLQPGIYRC  60
MDEKLCICQA CDWIGNGCSA PGHRLQSLQF YMGCPSLSDF SRLWSSVLDL PSATGLKAGW  120
GSMNSFTSSY CKDQTPFLPD ESNPSKVISF IFSLLINQSQ SQGCSNFKDL GLNEGGDLCQ  180
GINMDDVAVN FENSDEMIGS SQGHSTCRYD NAGMDSRLMD KNLSMGLGFP GGQVHASVSL  240
SLSNVTGESS AADYQDCGLS PAFLAGESPW TSNLDAHCPQ ARDKAKMRYN EKKKTRTFGK  300
QIRYASRKAR ADTRKRVRGR FVKAGEAYDY DPLTSTSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4407710.0AM440771.2 Vitis vinifera contig VV78X088054.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019078857.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11 isoform X3
SwissprotQ9LJ441e-105COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLF6HIK80.0F6HIK8_VITVI; Uncharacterized protein
STRINGVIT_12s0059g02500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-107B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. OrdoƱez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]