PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01030605001
Common NameLOC100261842, VIT_12s0059g02310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HD-ZIP
Protein Properties Length: 758aa    MW: 82698.7 Da    PI: 5.7392
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01030605001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2090145156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  GSVIVT01030605001  90 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 145
                        688999***********************************************999 PP

2START224.14.3e-702784981206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela +a++el+++a+ +ep+W  s     +++ +de++++f+++ +     ++ ea+r+++vv+m++  lve+l+d++ qW++ +     +a
  GSVIVT01030605001 278 ELAVAAMEELFRMAQMGEPLWLPSLdgttTELSEDEYIRSFPRGIGpkppgFKCEASRETAVVIMNHISLVEILMDVN-QWSTVFSgivsRA 368
                        57899***********************99*************999********************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +tlev+s+g      ga q+m+ae+q++splvp R+++fvRy++q+ +g+w++vdvS+d+ ++ p    vvR++++pSg+li++++ng+skv
  GSVIVT01030605001 369 MTLEVLSTGvagnynGAFQVMTAEFQVPSPLVPtRESYFVRYCKQHADGTWAVVDVSLDNLRPSP----VVRCRRRPSGCLIQEMPNGYSKV 456
                        ***************************************************************98....7********************** PP

                        EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        twvehv++++r +h+++++lv+sgla+gak+wvatl+rqce+
  GSVIVT01030605001 457 TWVEHVEVDDRGVHNIYKQLVNSGLAFGAKRWVATLDRQCER 498
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2271145IPR009057Homeodomain-like
SuperFamilySSF466897.94E-2076147IPR009057Homeodomain-like
PROSITE profilePS5007116.95787147IPR001356Homeobox domain
SMARTSM003894.8E-2088151IPR001356Homeobox domain
CDDcd000862.67E-1990148No hitNo description
PfamPF000464.3E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
SuperFamilySSF559618.49E-39269500No hitNo description
PROSITE profilePS5084846.215269501IPR002913START domain
CDDcd088751.06E-131273497No hitNo description
SMARTSM002341.5E-67278498IPR002913START domain
PfamPF018529.7E-59279498IPR002913START domain
Gene3DG3DSA:3.30.530.205.6E-8372498IPR023393START-like domain
SuperFamilySSF559613.2E-24518749No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MPAGIMIPAT HMPSMMGRNG NVAAYGSSSG LSLGQPNMMD GQLHPLDMTQ NTSESEIARL  60
REDDFDSKSG SENHEGASGD DQDPNQRPKK KRYHRHTQHQ IQEMEAFFKE CPHPDDKQRK  120
ELSRELGLEP LQVKFWFQNK RTQMKTQHER HENTQLRSEN EKLRTENLRY REALSNASCP  180
NCGGPTAIGE MSFDEHHLRL ENARLREEID RISAIAAKYV GKPVVNYPLI PQVPTRPLDL  240
GVGNFGAQPG LGGELFGASD LLRSINGPTE ADKPMIIELA VAAMEELFRM AQMGEPLWLP  300
SLDGTTTELS EDEYIRSFPR GIGPKPPGFK CEASRETAVV IMNHISLVEI LMDVNQWSTV  360
FSGIVSRAMT LEVLSTGVAG NYNGAFQVMT AEFQVPSPLV PTRESYFVRY CKQHADGTWA  420
VVDVSLDNLR PSPVVRCRRR PSGCLIQEMP NGYSKVTWVE HVEVDDRGVH NIYKQLVNSG  480
LAFGAKRWVA TLDRQCERLA SAMATNIPTG EVGVITSQEG RKSMLKLAER MVISFCAGVS  540
ASTAHTWTTL SGSGADDVRV MTRKSVDDPG RPPGIVLSAA TSFWLPVPPK RVFDFLRDEN  600
SRSEWDILSN GGVVQEMAHI ANGQDTGNCV SLLRVNSANS SQSNMLILQE SCTDSTASFV  660
IYAPVDVVAM NMVLNGGDPD YVALLPSGFA ILPDGTTAHG GVIGEVGSGG SLLTVAFQIL  720
VDSVPTAKLS LGSVATVNNL IACTVDRIKA AVSCENA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.118680.0flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3806500.0FQ380650.1 Vitis vinifera clone SS0ACG42YJ07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657311.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X4
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLD7TEM30.0D7TEM3_VITVI; Uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2
Publications ? help Back to Top
  1. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]